Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate PP_0283 PP_0283 Arginine/ornithine transport ATP-binding protein AotP
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >FitnessBrowser__Putida:PP_0283 Length = 257 Score = 318 bits (815), Expect = 7e-92 Identities = 156/247 (63%), Positives = 200/247 (80%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 LE+++LHKRYG E+LKG+SL A GDVISI+GSSGSGKST LRCINLLE PH G+IL+ Sbjct: 8 LEIRNLHKRYGEQEILKGISLTARDGDVISILGSSGSGKSTLLRCINLLENPHQGEILVA 67 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 E LKL A K+G L AAD +Q+ R+RS + VFQ+FNLW HM+ ++NI+EAP VLG SK Sbjct: 68 GEALKLKAAKNGDLIAADNRQINRVRSEIGFVFQNFNLWPHMSILDNIIEAPRRVLGQSK 127 Query: 124 TEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 EA E AE LNKVG+ ++ +YP +SGG+QQR AIAR LAM+P+V+LFDEPTSALDPE Sbjct: 128 AEAIEAAEALLNKVGIYDKRHSYPAQLSGGQQQRAAIARTLAMKPKVILFDEPTSALDPE 187 Query: 184 LVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSE 243 +V +VL V++ALA+EGRTM++VTHEM FAR VS+++VFLH+G+VEE G+P++V NP S Sbjct: 188 MVQEVLNVIRALAEEGRTMLLVTHEMSFARHVSSEVVFLHQGLVEEQGSPQQVFENPTSA 247 Query: 244 RLQQFLS 250 R +QF+S Sbjct: 248 RCKQFMS 254 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 257 Length adjustment: 24 Effective length of query: 230 Effective length of database: 233 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory