Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate PP_3597 PP_3597 Amino-acid ABC transporter, ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >FitnessBrowser__Putida:PP_3597 Length = 260 Score = 241 bits (614), Expect = 2e-68 Identities = 134/258 (51%), Positives = 177/258 (68%), Gaps = 12/258 (4%) Query: 19 QPVTAAIKLQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQP 78 +P + +++EG++K YG VL+ + L R+G+ I L G SGSGKST++RCIN LE Sbjct: 13 EPDPRPVLIRIEGLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVA 72 Query: 79 DAGVITLDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPR 138 G I +DGI + A TR Q +R+ + MVFQHFNL+ HM+VL+N +AP Sbjct: 73 QQGSIQVDGIDLA-----ATTREAAQ-----VRSDIGMVFQHFNLFPHMSVLDNCLLAPT 122 Query: 139 RVLDVSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDE 198 V +S +AE+RARMYL KVG+ S+ A +YP+ LSGGQQQRVAIARAL M+P I+LFDE Sbjct: 123 SVRGLSRKDAEERARMYLSKVGIESQ-AHKYPSQLSGGQQQRVAIARALCMKPRIMLFDE 181 Query: 199 PTSALDPELVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRVEEHGDARI 258 PTSALDPE+V EVL V+ LA G TML VTHEMGFARQV+ +VLFL G++ E ++ Sbjct: 182 PTSALDPEMVAEVLDVLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSPPQV 241 Query: 259 -LDQPNSERLQQFLSNRL 275 +QP +ER + FL+ L Sbjct: 242 FFNQPRTERAKAFLAQIL 259 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 260 Length adjustment: 25 Effective length of query: 251 Effective length of database: 235 Effective search space: 58985 Effective search space used: 58985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory