Align glycerol-3-phosphate oxidase; EC 1.1.3.21 (characterized)
to candidate PP_2910 PP_2910 L-2-hydroxyglutarate oxidase
Query= CharProtDB::CH_000554 (387 letters) >FitnessBrowser__Putida:PP_2910 Length = 416 Score = 125 bits (314), Expect = 2e-33 Identities = 88/280 (31%), Positives = 146/280 (52%), Gaps = 11/280 (3%) Query: 7 DICIIGGGIIGASVARELAKF--DKKIVVLEANPRLALETSSHNSGLVHGGFDPRPETLN 64 D IIGGGI+G S A L K D K+++LE A + HNSG++H G P +L Sbjct: 3 DFIIIGGGIVGMSTAMHLIKVYPDAKMLLLEKESGPARHQTGHNSGVIHAGVYYTPGSLK 62 Query: 65 AKLNVLGKKRYEDWIKEMDFPYLRIDSTIVAFNDEEMKHVHMLYDRGLINGLDPKEMQVI 124 A+ + G K + + + + +VA ND EM+ + L++R NGL E + Sbjct: 63 ARFCLEGNKATKAFCTQHGIRFDECGKLLVATNDLEMQRMKALWERTAANGL---ERYWL 119 Query: 125 DAKELQKREPNISKQAVGALVCNSSIAIDPVLLTTTLMRNAIKNGVELKVNSKVVDIKKV 184 A EL++REPNI +G + SS ++ +T + + G E++ ++VV +++ Sbjct: 120 SADELREREPNI--VGMGGIFVPSSGIVNYAQVTAAMAAEFQRAGGEIRYGAEVVGLQEQ 177 Query: 185 DNIFEIKTAKDEIIQAEVVVNVAGHYADVIANMAGY-GDFKLTTRRGEYRILDKSEAGIV 243 N ++T +DE + + +V +G AD + M G +F + RGEY +L K IV Sbjct: 178 ANEVIVRTQRDE-LHSRFLVTCSGLMADRVVGMLGLRTEFVICPFRGEYYLLPKQHNQIV 236 Query: 244 NSVVFMV--PTIHGKGVIVAPMLDGRVMVGPTALDGVPKE 281 N +++ + P++ GV + M+DG V VGP A+ + +E Sbjct: 237 NHLIYPIPDPSMPFLGVHLTRMIDGTVTVGPNAVLAMKRE 276 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 416 Length adjustment: 31 Effective length of query: 356 Effective length of database: 385 Effective search space: 137060 Effective search space used: 137060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory