Align Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale)
to candidate PP_3594 PP_3594 Amino acid ABC transporter, membrane protein
Query= uniprot:B2TBJ7 (240 letters) >FitnessBrowser__Putida:PP_3594 Length = 239 Score = 146 bits (369), Expect = 3e-40 Identities = 78/228 (34%), Positives = 125/228 (54%) Query: 4 IQMLGFGPEGWGGVLLLAALMTVALTLAALAVGAVFGALVAAAKLSRFRTLRVIGDIYTT 63 + +L F GWG LL AL+TV+L LA L +G G +VA A SR R R ++T Sbjct: 5 LSLLSFASGGWGQALLAGALVTVSLALACLPIGLPLGLVVALAARSRKRLPRAWATTFST 64 Query: 64 VFRGVPELLVIYLFYFGGSTLVTSVGQLFGAEGFVGVPPFVVGALAVGMISGAYQAEVYR 123 VFRG+PELL + + Y+G + G +G + F+ +A ++ A+ +E++ Sbjct: 65 VFRGLPELLTLLIIYYGCQIAAQKILAAMGYQGEFLINTFLAAMIAFSLVFAAFSSEIWL 124 Query: 124 SAVLAVSRGELEAARSIGMPTLTMARRILIPQVLRFALPGIGNVWQLSLKDSALISVTGL 183 +A + +G+LEA ++G+ T ++L+PQ+ R ALPG+ N W LKD++L+S L Sbjct: 125 AAFKTLPKGQLEACSALGLSKRTGFFKVLLPQLTRIALPGLSNNWLSLLKDTSLVSTISL 184 Query: 184 AELLRTSQVAAGSTHQYFTFFVVGGALYLIMTSISNRVFNRAEAHVGR 231 +L+R + +A T + F+ V YL+ ++S RVF E R Sbjct: 185 VDLMRQTNLAVSVTKEPMFFYGVACLGYLLFAALSGRVFAYIERRSNR 232 Lambda K H 0.327 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 104 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 239 Length adjustment: 23 Effective length of query: 217 Effective length of database: 216 Effective search space: 46872 Effective search space used: 46872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory