Align ABC transporter related (characterized, see rationale)
to candidate PP_4425 PP_4425 putative amino-acid ABC transporter ATP-binding protein y4tH
Query= uniprot:B2TBJ9 (263 letters) >FitnessBrowser__Putida:PP_4425 Length = 255 Score = 240 bits (613), Expect = 2e-68 Identities = 127/249 (51%), Positives = 170/249 (68%), Gaps = 1/249 (0%) Query: 9 LSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDGSVSLA 68 +S +++ K +G+ VL G+ LD G+ ++I+G SGSGKST LR L LE D+GS+ + Sbjct: 2 VSFRSVTKRYGNFTVLDGLELDVSAGEKVAIIGPSGSGKSTLLRVLMTLEGIDEGSILVE 61 Query: 69 GEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRVQKRSR 128 GE L + +GKL P+D + V VR ++GMVFQ FNL+ H T L+N+ E P+ V Sbjct: 62 GESLTHMQGRNGKLVPADAKHVRAVRGKIGMVFQGFNLFPHRTALQNVTEAPVHVLGVKP 121 Query: 129 AESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTSALDPE 188 AE+ + A LL VGL K HYP+ LSGGQQQRVAIARALAM PKVMLFDE TSALDPE Sbjct: 122 AEARDRAVQLLEMVGLGAKLDHYPSQLSGGQQQRVAIARALAMRPKVMLFDEVTSALDPE 181 Query: 189 LVGEVLRVMRSLAEEGR-TMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFVECKS 247 L GEVL V+R L E + TML+VTH+MGFAR ++RV F ++G++ G P ++F + Sbjct: 182 LCGEVLNVIRRLGSEHKLTMLMVTHQMGFAREFADRVCFFYKGRIHEQGAPGQLFETPQE 241 Query: 248 DRFRQFVSS 256 +R R F+S+ Sbjct: 242 ERTRSFLSA 250 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 255 Length adjustment: 24 Effective length of query: 239 Effective length of database: 231 Effective search space: 55209 Effective search space used: 55209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory