Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate PP_3284 PP_3284 enoyl-CoA hydratase-isomerase
Query= BRENDA::Q5SLK3 (254 letters) >FitnessBrowser__Putida:PP_3284 Length = 257 Score = 147 bits (371), Expect = 2e-40 Identities = 91/250 (36%), Positives = 134/250 (53%), Gaps = 5/250 (2%) Query: 7 QDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEF 66 + GV ++TL RPE LNA+ ELL L AAL+ D VRA ++TG+ +AF+AG D+ E Sbjct: 11 EHGVQLITLQRPEALNALCTELLAELAAALQAAGNDEHVRATVITGSAKAFAAGADIREM 70 Query: 67 GDRKPDYEAHLRRYNRVV--EALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASF 124 DR + RV ++++ KPL+ AVNG A G G LA+ D+ +A+ A F Sbjct: 71 ADRDL---VGILNDPRVAHWQSIAAFAKPLIAAVNGYALGGGCELAMCADIVIASTDARF 127 Query: 125 TTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLME 184 + +G++P +G + L R VG A +++L ++A A GLV + E +E Sbjct: 128 GQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAITALRAQQAGLVSEITQPELTVE 187 Query: 185 EALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFR 244 A+ +A+ +A A L K+ LL+ L L E T D +EG+RAF+ Sbjct: 188 RAMQVARSIAAKAPLAVRLAKEALLKAGDTDLASGLRFERHAFTLLAGTADRDEGIRAFQ 247 Query: 245 EKRPPRFQGR 254 EKR RFQGR Sbjct: 248 EKRQARFQGR 257 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 257 Length adjustment: 24 Effective length of query: 230 Effective length of database: 233 Effective search space: 53590 Effective search space used: 53590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory