Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate PP_5137 PP_5137 ferric iron ABC transporter, ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__Putida:PP_5137 Length = 352 Score = 172 bits (436), Expect = 9e-48 Identities = 99/233 (42%), Positives = 141/233 (60%), Gaps = 8/233 (3%) Query: 32 DILSRSGCTVGLNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNI 91 +I R G LNDVSL I AG++ ++G SG GK+TL+R I L G + +I Sbjct: 14 NIHKRFGAFTALNDVSLDIAAGELVCLLGPSGCGKTTLLRCIAGLERQDRGTLYIGERDI 73 Query: 92 LDLGAKALRAFRMRRVSMVFQSFALMPHRTVLQNVVYGQRVRGVSKDDAREIGMKWIDTV 151 DL +A R ++FQS+AL P+ TV N+ YG + G ++ AR+ + ++ V Sbjct: 74 SDLSPQA------RDYGILFQSYALFPNLTVEANIAYG--LTGSGREQARQRVAEMLELV 125 Query: 152 GLSGYDAKFPHQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQLQR 211 GLSG + K+P QLSGG +QRV LARALA ++L+DE SALD +R + +L QLQR Sbjct: 126 GLSGSEKKYPGQLSGGQQQRVALARALAPSPSLLLLDEPMSALDARVREHLCTELRQLQR 185 Query: 212 NLAKTIVFITHDLDEALRIGSEIAILRDGQVVQVGTPNDILDNPANDYVARFV 264 L T + +TH+ DEA+ + IA++ +GQV Q TP +I D+PA +VA FV Sbjct: 186 QLGITTLMVTHNQDEAMLMADRIAVMNNGQVEQYATPQEIYDHPATPFVAEFV 238 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 352 Length adjustment: 27 Effective length of query: 248 Effective length of database: 325 Effective search space: 80600 Effective search space used: 80600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory