Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate SMc02739 SMc02739 glycine betaine transport ATP-binding ABC transporter protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >FitnessBrowser__Smeli:SMc02739 Length = 349 Score = 246 bits (628), Expect = 5e-70 Identities = 135/274 (49%), Positives = 185/274 (67%), Gaps = 8/274 (2%) Query: 1 MSNAAISKIEVKNVFKIFGNRSKEALELIRQNKTKDQVLAETGCVVGVNDLSLSIGTGEI 60 MS+A + KNV IFG + A++++ Q KT+D++ A TG V+GV SL+I GEI Sbjct: 1 MSDAVV----FKNVDIIFGKNPQLAVQMVDQGKTRDEIGAATGLVLGVAGASLTINEGEI 56 Query: 61 FVIMGLSGSGKSTLVRHFNRLIDPTSGAILVDGED----ILQLDMDALREFRRHKISMVF 116 V+MGLSGSGKSTL+R N L G + V + + + +LR+FR H +SMVF Sbjct: 57 LVLMGLSGSGKSTLLRAVNGLAPVVRGEVEVKTANGSLNPYRCNAKSLRDFRMHTVSMVF 116 Query: 117 QSFGLLPHKSVLDNVAYGLKVRGESKQVCAERALHWINTVGLKGYENKYPHQLSGGMRQR 176 Q F LLP ++V DNV +GL++ G + +R + V L + ++ ++LSGGM+QR Sbjct: 117 QQFALLPWRTVADNVGFGLELAGVADAERRKRVGEQLELVNLAKWADRKVNELSGGMQQR 176 Query: 177 VGLARALAADTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIG 236 VGLARA A I+LMDE FSALDPLIR +QD+LLE Q+ L KTI+F++HDLDEA RIG Sbjct: 177 VGLARAFATGAPILLMDEPFSALDPLIRTRLQDELLEFQRRLKKTIIFVSHDLDEAFRIG 236 Query: 237 NRIAILKDGKLIQVGTPREILHSPADEYVDRFVQ 270 NRIAI++ G++IQ GTP+EI+ PA++YV FVQ Sbjct: 237 NRIAIMEGGRIIQCGTPQEIVKKPANQYVADFVQ 270 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 349 Length adjustment: 27 Effective length of query: 249 Effective length of database: 322 Effective search space: 80178 Effective search space used: 80178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory