Align ABC transporter permease (characterized, see rationale)
to candidate SMc01951 SMc01951 high-affinity branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KC95 (309 letters) >FitnessBrowser__Smeli:SMc01951 Length = 300 Score = 276 bits (707), Expect = 3e-79 Identities = 145/302 (48%), Positives = 202/302 (66%), Gaps = 9/302 (2%) Query: 1 MDILLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGA 60 M+ +QQ++NGL LGS+Y +IA+GYTMVYGII +INFAHG++ M+G + ++ Sbjct: 1 MEYFVQQLVNGLTLGSIYGMIAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLLLTTF 60 Query: 61 MPGAPGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAM 120 + G P + LL+ ++ + AA N+ IE+VAYRPLR S RLAPLITAIGMSI+L Sbjct: 61 IAGVPVVLALLIMMVVGMLTAALWNWTIERVAYRPLRGSFRLAPLITAIGMSIVLSNFIQ 120 Query: 121 IIWKPNYKPYPTMLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAMRAT 180 + P KP P ++ SS +++ G ++ QI+I+ +TA+ L+ Y+VN T LGRA RAT Sbjct: 121 VTQGPRNKPIPPLV-SSVYDLFGISVSLKQIIIVVITAILLSVFWYIVNRTPLGRAQRAT 179 Query: 181 AENPRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFTAAV 240 ++ ++A+L+GV D IS TFI+GA LAA+AG MY YG T GF PG+KAFTAAV Sbjct: 180 EQDRKMAALLGVDVDRTISVTFIMGAALAAVAGTMYLMYYGVVVFTDGFAPGVKAFTAAV 239 Query: 241 FGGIGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRPSGL 300 GGIG+L GAV+GG+L+GLIE++ S Y Y D+ F +L I+L +PSG+ Sbjct: 240 LGGIGSLPGAVLGGLLIGLIESLWSAYFTI--------DYKDVATFSILAIVLIFKPSGI 291 Query: 301 LG 302 LG Sbjct: 292 LG 293 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 300 Length adjustment: 27 Effective length of query: 282 Effective length of database: 273 Effective search space: 76986 Effective search space used: 76986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory