Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate SMc01950 SMc01950 high-affinity branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KER0 (358 letters) >FitnessBrowser__Smeli:SMc01950 Length = 461 Score = 248 bits (632), Expect = 3e-70 Identities = 156/357 (43%), Positives = 213/357 (59%), Gaps = 34/357 (9%) Query: 7 NWIIGAVALLVL--PLILQSFGNA----WV-RIADLALLYVLLALGLNIVVGYAGLLDLG 59 NW AV LL++ P+I+ G WV L+YV+LA GLNIVVG AGLLDLG Sbjct: 104 NWSKIAVILLLIYPPVIVALVGVQGSLKWVDNFGIQILIYVMLAWGLNIVVGLAGLLDLG 163 Query: 60 YVAFYAVGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAP 119 YVAFYAVGAY +AL++S GL S W+++P+A LLAA +G +LG P Sbjct: 164 YVAFYAVGAYSYALLSSYF--------------GL--SFWVLLPIAGLLAACWGVVLGFP 207 Query: 120 TLKLRGDYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRLEVF 179 L+LRGDYLAIVTL FGEIIR+ L N +T G G+ I +FG+ + F Sbjct: 208 VLRLRGDYLAIVTLAFGEIIRLVLINW---TEVTKGTFGVSGIAKATLFGIKFDATKDGF 264 Query: 180 ----GFDINSV---TLYYYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGIN 232 G ++S +YL L L +++ + RL+ IGRAW A+REDEIA +++GIN Sbjct: 265 AAMMGLPMSSAYYKIFLFYLILGLALLTAFVTIRLRRMPIGRAWEALREDEIACRSLGIN 324 Query: 233 TRNMKLLAFGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVIL 292 T KL AF GA FGG +G+ F QGFVSPESF +ES +I+A+VVLGG+G + G+ + Sbjct: 325 TVTTKLTAFATGAMFGGFAGSFFAVRQGFVSPESFVFLESAVILAIVVLGGMGSLTGIAI 384 Query: 293 GAVLLSALPEVLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGLWPSPE 349 AV++ E+LR + L+ + + R L+ LAM+++M+ +PRG S E Sbjct: 385 AAVVMIGGTEILRELTF-LKMIFGPTFTPELYRMLIFGLAMVVVMVWKPRGFVGSRE 440 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 461 Length adjustment: 31 Effective length of query: 327 Effective length of database: 430 Effective search space: 140610 Effective search space used: 140610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory