Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate GFF1588 PS417_08080 ABC transporter ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__WCS417:GFF1588 Length = 323 Score = 252 bits (644), Expect = 8e-72 Identities = 139/300 (46%), Positives = 192/300 (64%), Gaps = 2/300 (0%) Query: 23 FPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRPDGGKIFFEGKDIT 82 F K+ ++AV+G+S+ + GETLGLVGESG GKSTLGR IL L G++ F+G D+ Sbjct: 21 FGLNKQWVRAVNGVSLSLAAGETLGLVGESGSGKSTLGRAILHLNPISAGQVLFDGIDMA 80 Query: 83 NLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKIGTKKERRKRVEELLDM 142 + + ++ R + +IFQDP +LNP+ T+G I + L + + + RV ELLD+ Sbjct: 81 HGSAIDITRLRHETAMIFQDPYAALNPRHTIGETIAEVLRVQRKVAPERISDRVNELLDL 140 Query: 143 VGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSALDVSIQAQIIDLLEEI 202 VG+ E + P SGGQ QR+GIARALA+ P+ I+ DE V+ALDVSIQ QII+LL E+ Sbjct: 141 VGLRPELASRKPGSLSGGQCQRVGIARALAVEPRLIIADECVAALDVSIQGQIINLLLEL 200 Query: 203 QQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFLNPIHPYTRALLKSVPK 262 QQ+M ++ LFIAH+LA+V + +VAVMYLGKIVE G V+ +F P HPYT AL++++P+ Sbjct: 201 QQRMHLAILFIAHDLAIVRRLCDRVAVMYLGKIVEEGPVESVFTAPRHPYTAALIQAIPE 260 Query: 263 IPWDGQKQRFYSLKGELPSPIDLPKGCRFQTRCTEKKAICFEKEPELTEVEKNHFVSCHL 322 I + L GE PSP++LP GC F RC + +C P T H SC L Sbjct: 261 ID-PHRPLPTEPLPGEPPSPLNLPTGCAFHPRCRHARTMCSVVLPP-THFLHEHRYSCVL 318 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 323 Length adjustment: 28 Effective length of query: 300 Effective length of database: 295 Effective search space: 88500 Effective search space used: 88500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory