Align Inositol transport system permease protein (characterized)
to candidate GFF2674 PS417_13640 ribose ABC transporter permease
Query= reanno::WCS417:GFF2333 (340 letters) >FitnessBrowser__WCS417:GFF2674 Length = 325 Score = 210 bits (534), Expect = 5e-59 Identities = 124/305 (40%), Positives = 184/305 (60%), Gaps = 19/305 (6%) Query: 35 LVFELFGWIVRDQSFLMNSQRLVLMILQVSIIGLLAIGVTQVIITTGIDLSSGSVLALSA 94 L+ L G+ + ++FL Q L ++ Q S+ +LA G+T VI+T GIDLS G++LA SA Sbjct: 28 LILLLVGFALASENFL-TMQNLSIISQQASVNVVLAAGMTFVILTAGIDLSVGAILAASA 86 Query: 95 MIAASLAQTSDFSRAVFPSLTDLPVWIPVAMGLGVGLLAGAINGSIIAVTGIPPFIATLG 154 ++A + + F +A G+G GLL G +NG +IA +PPFI TLG Sbjct: 87 VVALQASMSPQFGM------------FGIAAGIGFGLLLGLVNGGLIAFMRLPPFIVTLG 134 Query: 155 MMVSARGLARYYTEGQPVSMLSDSYTAIGHGAMPVIIFLVVAVIFHIAL-----RYTKYG 209 + + RGLAR + + V + IG+ ++ + +LV+ + +AL R T G Sbjct: 135 ALTAMRGLARLLADDKTVFNPDLPFAFIGNDSLLGVPWLVIIAVAVVALSWFILRRTVMG 194 Query: 210 KYTYAIGGNMQAARTSGINVKRHLIIVYSIAGLLAGLAGVVASARA-ATGQAGMGMSYEL 268 Y++GGN +AAR SGI V + L+ VY+++G LAGL V++++R A +G SYEL Sbjct: 195 VQIYSVGGNPEAARLSGIKVWKVLLFVYAMSGALAGLGAVMSASRLFAANGLQLGQSYEL 254 Query: 269 DAIAAAVIGGTSLAGGVGRITGTVIGALILGVMASGFTFVGVDAYIQDIIKGLIIVVAVV 328 DAIAA ++GGTS GGVG I GT+IGALI+ V+ +G +GV Q IIKG++I+ AV Sbjct: 255 DAIAAVILGGTSFTGGVGTIGGTLIGALIIAVLTNGLVLLGVSDIWQYIIKGIVIIGAVA 314 Query: 329 IDQYR 333 +D+YR Sbjct: 315 LDRYR 319 Lambda K H 0.325 0.140 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 325 Length adjustment: 28 Effective length of query: 312 Effective length of database: 297 Effective search space: 92664 Effective search space used: 92664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory