Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate GFF2674 PS417_13640 ribose ABC transporter permease
Query= TCDB::G4FGN4 (313 letters) >FitnessBrowser__WCS417:GFF2674 Length = 325 Score = 212 bits (539), Expect = 1e-59 Identities = 128/310 (41%), Positives = 187/310 (60%), Gaps = 10/310 (3%) Query: 9 REAGIFLILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLSVG 68 R G+ +LI ++V + + FLT++N+ + S +++ GMT VI+T+GIDLSVG Sbjct: 20 RTVGMLPVLILLLVGFALASENFLTMQNLSIISQQASVNVVLAAGMTFVILTAGIDLSVG 79 Query: 69 SILGAASVVMGLLMDEKGLSPFLSVVIGLAVGVGFGL----ANGLLITKARLAPFISTLG 124 +IL AAS V+ L + +SP + G+A G+GFGL NG LI RL PFI TLG Sbjct: 80 AIL-AASAVVAL---QASMSPQFGM-FGIAAGIGFGLLLGLVNGGLIAFMRLPPFIVTLG 134 Query: 125 MLSVGRGLAYVMSGGWPISPFPESFTVHGQGMVGPVPVPVIYMAVIGVIAHIFLKYTVTG 184 L+ RGLA +++ + F G + VP VI + ++ L+ TV G Sbjct: 135 ALTAMRGLARLLADDKTVFNPDLPFAFIGNDSLLGVPWLVIIAVAVVALSWFILRRTVMG 194 Query: 185 RRIYAIGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGVAQP-NAGQGYEL 243 +IY++GGN EA++L GIK ++L+ VY ++G LA + + L A GQ YEL Sbjct: 195 VQIYSVGGNPEAARLSGIKVWKVLLFVYAMSGALAGLGAVMSASRLFAANGLQLGQSYEL 254 Query: 244 DVIAATVIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIVIIIAIA 303 D IAA ++GGTS +GG GTI G +GA+I+ VL NG++LLGVS WQ ++ GIVII A+A Sbjct: 255 DAIAAVILGGTSFTGGVGTIGGTLIGALIIAVLTNGLVLLGVSDIWQYIIKGIVIIGAVA 314 Query: 304 IDQIRRAKER 313 +D+ R++ R Sbjct: 315 LDRYRQSGAR 324 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 325 Length adjustment: 28 Effective length of query: 285 Effective length of database: 297 Effective search space: 84645 Effective search space used: 84645 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory