Align Erythritol/L-threitol dehydrogenase; EC 1.1.1.- (characterized)
to candidate GFF2362 PS417_12045 iditol 2-dehydrogenase
Query= SwissProt::A0QXD8 (362 letters) >FitnessBrowser__WCS417:GFF2362 Length = 371 Score = 397 bits (1020), Expect = e-115 Identities = 192/361 (53%), Positives = 244/361 (67%), Gaps = 1/361 (0%) Query: 1 MSNQVPEKMQAVVCHGPHDYRLEEVAVPQRKPGEALIRVEAVGICASDLKCYHGAAKFWG 60 +S +P+ MQAVVCHGP DYRLE V VP P E L +VE GIC D+K Y GA FWG Sbjct: 12 LSPVIPKTMQAVVCHGPEDYRLETVDVPVPGPDEILTKVELCGICMGDIKTYRGAPSFWG 71 Query: 61 DENRPAWAETMVIPGHEFVGRVVELDDEAAQRWGIAVGDRVVSEQIVPCWECLFCKRGQY 120 D +P + + +IPGHEFV RVV L A +R G+ VGDRV+SEQIVPCW C FC GQY Sbjct: 72 DAEQPRYVKPPMIPGHEFVCRVVALGPGAEKR-GVKVGDRVISEQIVPCWGCRFCNHGQY 130 Query: 121 HMCQPHDLYGFKRRTPGAMASYMVYPAEALVHKVSPDIPAQHAAFAEPLSCSLHAVERAQ 180 MCQ HDLYGF+ GAMA YM++ E ++HKV I A EPL+CSLHA ERA Sbjct: 131 WMCQKHDLYGFQNNVQGAMAQYMIFTKEGIIHKVPDSIAPDEAILIEPLACSLHAAERAN 190 Query: 181 ITFEDTVVVAGCGPIGLGMIAGAKAKSPMRVIALDMAPDKLKLAEKCGADLTINIAEQDA 240 + F+D VVVAG G +GLG+I + ++P ++I LDM P++ LA + GAD N AE+D Sbjct: 191 VDFDDVVVVAGAGTLGLGIIGAVRMRNPKKLIVLDMKPERAALALRMGADEVWNPAEEDV 250 Query: 241 EKIIKDLTGGYGADVYIEGTGHTSAVPQGLNLLRKLGRYVEYGVFGSDVTVDWSIISDDK 300 I+++T GYG D+YIE TGH AV QGL +LRKLGR+VE+ VF + TVDWSII D K Sbjct: 251 LAKIREITDGYGCDIYIEATGHHKAVNQGLAMLRKLGRFVEFSVFNDEATVDWSIIGDRK 310 Query: 301 ELDVLGAHLGPYCWPAAIKMIESGALPMDEICTHQFPLTEFQKGLDLVASGKESVKVSLI 360 ELDVLG+HLGPY +P AI I + + M ++ TH F L +F++ ++ G +S+KV L Sbjct: 311 ELDVLGSHLGPYMYPRAIDFIGNRKIDMRDVVTHTFALADFKEAFAVMERGDKSLKVVLQ 370 Query: 361 P 361 P Sbjct: 371 P 371 Lambda K H 0.320 0.137 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 371 Length adjustment: 30 Effective length of query: 332 Effective length of database: 341 Effective search space: 113212 Effective search space used: 113212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory