Align Xylonolactonase (EC 3.1.1.68) (characterized)
to candidate GFF2160 PS417_11020 gluconolaconase
Query= reanno::Korea:Ga0059261_1893 (295 letters) >FitnessBrowser__WCS417:GFF2160 Length = 287 Score = 141 bits (356), Expect = 2e-38 Identities = 91/281 (32%), Positives = 138/281 (49%), Gaps = 19/281 (6%) Query: 16 APLLEGPVWVQRDAALWFVDIKSHRIHRFDPASGERRSWDAPAQVGFCLPAANGKFVAGL 75 A L EGP W AL++V+I + R G+ + W P V +P +G + L Sbjct: 11 AQLGEGPFWDAPTQALYWVNIAGKQALRL--MGGQLQVWQLPEHVSAFIPCESGDALVTL 68 Query: 76 QTGLAIFDPADRSFTPLTDPEPALPGNRLNDGTVDPAGRLWFGTMDDGESEA-------- 127 +G+ D A + T L +P PGNR N+ D +GRLW GTM + E Sbjct: 69 SSGVYRLDLATEALTLLCVADPQ-PGNRGNEARCDASGRLWLGTMQNNIGEQGEDLPITR 127 Query: 128 -TGRIYRLGGDGRCVAETAAVSISNGPAVSPDGRTLYHVDTLGGVIHSAAIGDDGILGDS 186 +G ++R+ D + + + I N S DGR ++ D+L G ++ AI DG L + Sbjct: 128 RSGGLFRIDADAQVTPLLSGLGIPNTLLWSDDGRHVHFGDSLDGTLYRHAIQPDGQLDPA 187 Query: 187 RVFATIPNSEGFPDGPAVDAEGCVWIGLYNGAAVRRYSPAGELLDVVAFPVGAITKVAFG 246 + + P+ G PDG A+D +G +W ++G+ + R +P GE+ +V PV T G Sbjct: 188 QTWFG-PHERGGPDGSAMDVDGYIWNARWDGSCLLRLTPDGEVDRIVELPVSRPTSCVLG 246 Query: 247 GPDLRTVYATTASKHLDADGRAEEPHAGDLFAFRVSVPGMP 287 GP+L T+Y T+A+ LD P G + A V VPG P Sbjct: 247 GPNLTTLYITSAASPLD------HPLDGAVLAMEVDVPGKP 281 Lambda K H 0.319 0.139 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 38 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 287 Length adjustment: 26 Effective length of query: 269 Effective length of database: 261 Effective search space: 70209 Effective search space used: 70209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory