Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate AZOBR_RS01325 AZOBR_RS01325 2-hydroxyacid dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >FitnessBrowser__azobra:AZOBR_RS01325 Length = 329 Score = 293 bits (750), Expect = 4e-84 Identities = 154/328 (46%), Positives = 219/328 (66%), Gaps = 7/328 (2%) Query: 2 KPKVFITRQIPENGIKMIEKFYEIELWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKEL 61 KP V +TR++P+ + + ++ L D + L++ V+ D LV VTD++D+E+ Sbjct: 6 KPLVVVTRKLPDVIETRMMELFDARLNSDDEPLTHAQLIDVVQTADVLVPTVTDRIDREV 65 Query: 62 LENA-PKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIV 120 +E A P+L++IA + G D+ID++ A +RGI VTNTPGVLT+ TAD+ ALLLAV RR+ Sbjct: 66 IEKAGPQLRLIASFGTGVDHIDLKAARERGISVTNTPGVLTEDTADMTMALLLAVGRRVA 125 Query: 121 EADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYYS 180 E + VRSG+WK GW P LG+ ++GK LGI+G GRIGQALA+RA+ FGM I Y++ Sbjct: 126 EGERLVRSGQWK----GWGPTTMLGHRIQGKRLGILGMGRIGQALARRARAFGMSIHYHN 181 Query: 181 RTRK-PEAEEEIGAEYVD-FETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILIN 238 R R P+ E+E+ A Y + + +L D +S++ P T TYH++ E+ LKL++P+ ++N Sbjct: 182 RRRVYPDVEQELEATYWESLDQMLARMDVVSINCPHTPATYHLLSERRLKLLRPHCFIVN 241 Query: 239 TSRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEARE 298 TSRG V+D AL + L +G IAGAGLDVFE EP N +L +L NVVL PH+GSAT E R Sbjct: 242 TSRGEVIDETALTRMLSKGEIAGAGLDVFEHEPAVNPKLLRLDNVVLLPHMGSATIEGRI 301 Query: 299 GMAELVAKNLIAFAKGEIPPNLVNKDVL 326 M E V N+ FA G PP+ V + +L Sbjct: 302 DMGEKVIINIKTFADGHAPPDRVLETLL 329 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 329 Length adjustment: 28 Effective length of query: 303 Effective length of database: 301 Effective search space: 91203 Effective search space used: 91203 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory