Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate AZOBR_RS00060 AZOBR_RS00060 sn-glycerol-3-phosphate ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >FitnessBrowser__azobra:AZOBR_RS00060 Length = 357 Score = 313 bits (801), Expect = 6e-90 Identities = 175/362 (48%), Positives = 233/362 (64%), Gaps = 8/362 (2%) Query: 1 MTSVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQI 60 M +V + + ++GAV + +++ + GEFLVLLG SGCGKSTLL +AGL ++ G+I Sbjct: 1 MATVDLNQVRKSYGAVEAIKGIDISVADGEFLVLLGPSGCGKSTLLRMVAGLESITGGEI 60 Query: 61 FIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEI 120 I R V EPKDR I MVFQ+YALYP M+V N+++GLK+ +P AEI+ RV +A+EI Sbjct: 61 AIGGRVVNGLEPKDRDIAMVFQNYALYPHMSVFDNMAYGLKIRGLPKAEIQARVAKAAEI 120 Query: 121 LQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLH 180 L++ L R+PS+LSGGQRQRVA+GRA+VR+ FLFDEPLSNLDAKLR+++RVEIKRL Sbjct: 121 LELNRFLDRRPSQLSGGQRQRVAMGRAIVREPAAFLFDEPLSNLDAKLRTQMRVEIKRLQ 180 Query: 181 QSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMN 240 L T +YVTHDQ+EA+TLADRI VM GV +Q+ P+ +Y P +LFVAGFIGSP MN Sbjct: 181 DRLGITSLYVTHDQVEAMTLADRILVMNHGVAEQVGTPLEVYQRPASLFVAGFIGSPPMN 240 Query: 241 FFRGEVEPKDGRSFVRAGGIAFDVTAYPAHTRLQPGQKVVLGLRPEHVKVDEARDGEPTH 300 + G++ GG AF P G+ V LG+RPEH+ V G Sbjct: 241 VLDARFDGA-GQAVALPGGTAF---LLPRPRPDMAGRPVKLGVRPEHLAV---TPGHGPL 293 Query: 301 QAVVDIEEPMGADNLLWLTFA-GQSMSVRIAGQRRYPPGSTVRLSFDMGVASIFDAESEN 359 VD E +GAD +++ G+ M VR+AG G T+R+ +FDAE+ Sbjct: 294 IVTVDXVEALGADTVVYGRLPDGEGMVVRVAGLPFCREGETLRVGAPPDALHLFDAETGR 353 Query: 360 RL 361 RL Sbjct: 354 RL 355 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 357 Length adjustment: 29 Effective length of query: 332 Effective length of database: 328 Effective search space: 108896 Effective search space used: 108896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory