Align Senescence marker protein-30 family protein (characterized, see rationale)
to candidate AZOBR_RS22710 AZOBR_RS22710 gluconolactonase
Query= uniprot:Q888H2 (294 letters) >FitnessBrowser__azobra:AZOBR_RS22710 Length = 296 Score = 291 bits (745), Expect = 1e-83 Identities = 139/292 (47%), Positives = 184/292 (63%), Gaps = 2/292 (0%) Query: 1 MDAELIVDAQNATGESPVWSVREQALYWVDIPNGELHRWDSSQDRTRSWKAPQMLACIAA 60 ++A D +N TGE+PVW + W+DIP +HR D S R W P+M+ + Sbjct: 1 LEAVFDPDLRNGTGENPVWDAERGSWTWIDIPARTIHRLDPSSGAHRRWTLPEMIGSLVL 60 Query: 61 DSRGGWIAGMENGLYHLQ-PCDDGSLISTLLASVEHAQTGMRFNDGRCDRQGRFWAGTML 119 GG + E G++ + P + G + T LA+ + GMRFNDGRCDRQGRFW +M+ Sbjct: 61 RPDGGVVCACETGVFDVDLPGEGGEAVVTALATHRFPKEGMRFNDGRCDRQGRFWLSSMV 120 Query: 120 MDMAAGAVVGALYRYSAGQKTLEAQLKDLIVPNGLAFSPDGKTMYLSDSHPAVQKIWAFD 179 MD++ G G +R++ E I+PNG AFSPDG+T+Y SDSH V+ +WA+D Sbjct: 121 MDISKGDSSGLWHRFTRADGLTETGTGGYIIPNGSAFSPDGRTLYASDSHRDVRMVWAWD 180 Query: 180 YDTDSGTPHDRRLFVDMNNYLGRPDGAAIDADGCYWICGNDAGLVHRFTPNGKLDRSLVV 239 YDTD+GT +RR FVDM +GRPDGAA+D DGCYWIC D G + RFTPNG LDR + V Sbjct: 181 YDTDTGTADNRRPFVDMRAMVGRPDGAAVDIDGCYWICCLDEGCIKRFTPNGDLDRRIEV 240 Query: 240 PVKKPAMCAFGGPNLDTLFVTSIRPG-GDLSDQPLAGGVFALRPGVKGLEEP 290 P++KP MCAFGGP+L T+ VTS+ G DL++ P G V PG +GL EP Sbjct: 241 PMRKPTMCAFGGPDLRTMLVTSLSRGPADLAEDPHGGRVLMFDPGAQGLPEP 292 Lambda K H 0.320 0.138 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 453 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 296 Length adjustment: 26 Effective length of query: 268 Effective length of database: 270 Effective search space: 72360 Effective search space used: 72360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory