Align Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale)
to candidate AZOBR_RS27940 AZOBR_RS27940 ABC transporter permease
Query= uniprot:B2T9V8 (351 letters) >FitnessBrowser__azobra:AZOBR_RS27940 Length = 329 Score = 140 bits (352), Expect = 6e-38 Identities = 93/303 (30%), Positives = 155/303 (51%), Gaps = 6/303 (1%) Query: 46 ALALLIVIGAFISPSFLTKANLISVLGASAALALVVLAESLIVLTGKFDLSLESTVGIAP 105 ALA LIV+G ++P FL+ N+ +VL +A + ++ + + ++ G DLS+ S A Sbjct: 22 ALAALIVLGTIVNPVFLSPGNIGNVLTRTAFIGIIAVGATFVITAGGIDLSVGSLAAFAS 81 Query: 106 AVGAMLVMPAASAGFGMQWPAAA-GLLAIVVVGAVIGFINGFLVVRLRLNAFIVTLAMLI 164 V ++VM A G P G+L + +G V G +NG LV + R+ AFIVTL + Sbjct: 82 GV-MIVVMNALVGSMGAGLPVILIGVLVALGLGLVAGLVNGLLVTKGRMEAFIVTLGTMG 140 Query: 165 VLRGMLVGATKGGTLF---DMPTSFFALATTIVLGLPLSVWLAAAAFAIAAFMLRYHRLG 221 + R ++ GGTL ++ T + + V G+ + A I A ++ R G Sbjct: 141 IFRSLVTYIADGGTLSLNSEIRTIYRPVYYGGVFGISYPILAFAVVALIGALIMYRTRFG 200 Query: 222 RALYAIGGNPEAARAAGIRVERITWGVFVLGSILASVGGLIVTGYVGAINANQGNGMIFT 281 R AIG + + AR + I V+R+ FVL I ++ +I +G+ +A G Sbjct: 201 RYCAAIGSSEDVARYSAINVDRVKLLAFVLQGICVAIAVVIYVPRLGSASATTGLLWELE 260 Query: 282 VFAAAVIGGISLDGGKGTMFGALTGVLLLGVVQNLLTLAQVPSFWIQ-AIYGAIILGSLM 340 AA +IGG L GG G ++G + G ++L ++ N+L L S ++ I G II+ +++ Sbjct: 261 AIAAVIIGGTMLKGGYGRIWGTVVGAVMLTLIDNILNLTGAISVYLNGTIQGVIIIVAVL 320 Query: 341 VAR 343 + R Sbjct: 321 LQR 323 Lambda K H 0.326 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 329 Length adjustment: 28 Effective length of query: 323 Effective length of database: 301 Effective search space: 97223 Effective search space used: 97223 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory