Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate AZOBR_RS24710 AZOBR_RS24710 ABC transporter ATP-binding protein
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__azobra:AZOBR_RS24710 Length = 360 Score = 200 bits (508), Expect = 6e-56 Identities = 106/259 (40%), Positives = 162/259 (62%), Gaps = 5/259 (1%) Query: 1 MTTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPT 60 M+ IR++NL K F A+ + + + +G +LGPSG GK+T L+L+AG E PT Sbjct: 1 MSGIRIKNLRKSFGT----YTALHGIDLQVPNGTLLALLGPSGCGKSTTLQLLAGFEAPT 56 Query: 61 SGYIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIE 120 G I+ D+ +SS R V+ PEKRGI++VFQN+A++P+ TV +N+AF L + ++PK +I Sbjct: 57 EGEIWADDVLLSSARGVL-PPEKRGISLVFQNYAVWPHKTVAENVAFGLAIRRLPKAEIA 115 Query: 121 NKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRES 180 ++ + L + +RYP ELSGGQ QR A+ARAL +P++LLLDEP SNLDA +RE Sbjct: 116 ERLDRTLRTVRLEALRDRYPSELSGGQQQRVALARALAVEPRILLLDEPLSNLDAHLREE 175 Query: 181 ARALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIA 240 R +R++ LTT+ V+HD ++ A++ V+ +G Q+G+P +I+E P+ +A Sbjct: 176 MRFEIRQVHDLLGLTTVYVTHDQSEALVTADRIAVMKSGHLQQLGSPEDIFERPSNAFVA 235 Query: 241 RLTGEINLIQAKIIENNAI 259 G N + N AI Sbjct: 236 TFIGANNELAGTSEGNGAI 254 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 360 Length adjustment: 30 Effective length of query: 341 Effective length of database: 330 Effective search space: 112530 Effective search space used: 112530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory