Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate AZOBR_RS21145 AZOBR_RS21145 NADP-dependent malic enzyme
Query= curated2:Q59330 (328 letters) >FitnessBrowser__azobra:AZOBR_RS21145 Length = 772 Score = 172 bits (437), Expect = 2e-47 Identities = 109/332 (32%), Positives = 171/332 (51%), Gaps = 13/332 (3%) Query: 3 IIQSIIEKAKSNKKKIVLPEGAEPRTLKAADIVLKEGIADLVLLGNADEIRN--AAEGLD 60 +++ +I KAK+ K+IV EG EPR L+ A +V+ +GIA VLLG AD I A GL Sbjct: 429 VMKPVITKAKAAPKRIVYAEGEEPRVLRCAQVVVDDGIAHPVLLGRADVIERTIADMGLR 488 Query: 61 I---SKAEIIDPLKSEKFDKYATDFYELRKNKGITLEKAKETIKDN-IYFGCMMVKEGYA 116 I E+I+ + + YA + +L +G++ A ++ FG +MV+ G A Sbjct: 489 IRIGKDVEVIEAARDLRCHNYAEVYRQLMGRRGVSPANALNVVRTQPSVFGALMVRRGEA 548 Query: 117 DGLVSGAIHATADLLRPAFQIVKTAPGAKIVSSFFIMEVPNCEFGENGVFLFADCAVNPS 176 DG+V G D ++ G K+ + N + G D VNP Sbjct: 549 DGMVCGTSGRYGDHFNHVMDVIGLRKGVKVAGAM------NGLISQKGTHFICDTYVNPD 602 Query: 177 PNAEELASIAVQSANTAKTLLGMEPRVAMLSFSTKGSASHELVDKVRTATEIAKNLIPDV 236 P AE++A IA +A K G+EP+VA+LS S GSA K+R A ++ PD+ Sbjct: 603 PTAEQVAEIARLAAEEVKRF-GIEPKVALLSHSNFGSADTPSARKMRLAYQLIAEENPDL 661 Query: 237 AIDGELQLDAALVKEVAELKAPGSPVAGRANVLIFPDLQAGNIGYKLVQRLAKANAIGPI 296 +DGE+ DAAL + + + P S + G AN+L+ P L A NI + +++ +A A +GP+ Sbjct: 662 EVDGEMHADAALSEVLRKGVLPDSRLKGEANLLVMPTLDAANIAFNMLKIMADAQNVGPM 721 Query: 297 TQGMGAPVNDLSRGCSYKDIVDVIATTAVQAQ 328 G PV+ ++ + + +V++ A V AQ Sbjct: 722 LLGAARPVHIVTPSVTTRGLVNMTAVAVVDAQ 753 Lambda K H 0.315 0.133 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 548 Number of extensions: 33 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 772 Length adjustment: 34 Effective length of query: 294 Effective length of database: 738 Effective search space: 216972 Effective search space used: 216972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory