Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate AZOBR_RS32455 AZOBR_RS32455 phosphate acetyltransferase
Query= curated2:Q9X448 (316 letters) >FitnessBrowser__azobra:AZOBR_RS32455 Length = 332 Score = 227 bits (578), Expect = 3e-64 Identities = 135/302 (44%), Positives = 176/302 (58%), Gaps = 1/302 (0%) Query: 14 RLIAAARAEAPAVTIVAHPCDETSLGGAIEAAEMGLITPILVAPEAKIRNVAAEHRLDLG 73 RL+A + A P T V +L A A +GLI P+LV I + A L Sbjct: 15 RLMARSAALEPVPTAVVAAGSPVALESARRATALGLIEPVLVGDPTAIADSARRIGWTLH 74 Query: 74 RREIVDVPHSHAAAAKAVALIREGRGELLMKGSLHTDELMHEVAASATGLRTQRRISHVF 133 +V AAA AVAL R G LMKG +HTD LM GLRT RR +H F Sbjct: 75 GACVVPARDDAAAARIAVALARSGDVGALMKGHIHTDTLMLAALHPKNGLRTGRRFTHAF 134 Query: 134 VMDVPGHTDTLFITDAAINIFPDLEAKRDIVQNAIDLWVAIGLGEPRVAILSAVETVTAK 193 M +PG L ITDAAIN+ P L + DI++NA++LW +G +PRVA+LS E VT + Sbjct: 135 HMTLPGSGRELVITDAAINVAPSLNTRLDIIRNAVELWRLVGGSDPRVALLSCTEEVTER 194 Query: 194 IPSTIEAAALCKMAERGQITGGVLEGPLAFDNAIDQEAARIKGINSPVAGHAQILVVPDL 253 +PS+++A L ++ ++ ++ G + GPLA D A+ EAARIK + P AG A ILVVP++ Sbjct: 195 VPSSMDADRLTRLCQQ-EVPGATVFGPLALDLAVSAEAARIKNLTHPCAGAADILVVPNI 253 Query: 254 EAGNMLAKNLTFLTHADAAGLVLGARVPIVLTSRADSVRTRLASCAVAALYAARRRAAQV 313 E GN L K L A AAG+VLGA VPIVLTSRAD R+A+ A+A + A RRR+A Sbjct: 254 ETGNALFKALVHFLDAVAAGVVLGAAVPIVLTSRADPPAARIAAAAIAQIVAGRRRSATP 313 Query: 314 AA 315 A Sbjct: 314 GA 315 Lambda K H 0.320 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 332 Length adjustment: 28 Effective length of query: 288 Effective length of database: 304 Effective search space: 87552 Effective search space used: 87552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory