Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate AZOBR_RS29750 AZOBR_RS29750 aldehyde dehydrogenase
Query= BRENDA::P42412 (487 letters) >FitnessBrowser__azobra:AZOBR_RS29750 Length = 484 Score = 271 bits (692), Expect = 5e-77 Identities = 162/473 (34%), Positives = 251/473 (53%), Gaps = 10/473 (2%) Query: 6 KLKNYINGEWVESKTDQYEDVVNPATKEVLC-QVPISTKEDIDYAAQTAAEAFKTWSKVA 64 ++ N+I G W + + D+VNP+ + L ++ +D+ A A A W Sbjct: 7 RITNFIAGSWRPGR--ERLDIVNPSNLDELAGSYSLAGADDVAEAVAAARAAQPQWRAAT 64 Query: 65 VPRRARILFNFQQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPSLMMG 124 V +R+ +L + L K+ELA + E GK +ALGE+ R F A G Sbjct: 65 VEQRSLVLDAISRALFDRKDELARIAATEGGKTIPDALGEITRAAHLARFFAAEALRAPG 124 Query: 125 DSLASIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSERTP-- 182 ++L S+ VE R P+GV+G + P+NFP+ P W A+A GN I KPSE+TP Sbjct: 125 ETLGSVRPGVEVDVTREPVGVIGLVTPWNFPVATPMWKIAPALAFGNAVIWKPSEKTPGI 184 Query: 183 --LLTEKLVELFEKAGLPKGVFNVVYGAHDVVNGILEHPEIKAISFVGSKPVGEYVYKKG 240 +T + E E G+P +FN+V GA + G + A+SF GS G + + Sbjct: 185 SIAVTRLIAEALEAHGMPAALFNLVIGAGPNI-GAAVVDAVDAVSFTGSVNTGRRIAVRC 243 Query: 241 SENLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEF 300 +E + RVQ G +N +VL DA+ E V +A+ AG+RC A VE+ I D F Sbjct: 244 AERMIRVQLELGGQNPLVVLGDADPERAAEIGVNSAYFHAGQRCTATGRFIVEDSIHDAF 303 Query: 301 MAKLQEKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVC-DGRENVSD 359 +A + E++A +++G+ L +GPVI E + L YI+ GL+EGA+L GR + Sbjct: 304 VAAMTERMAALRVGHALLPETQIGPVIDEFQLTKNLHYIDTGLKEGAQLASGGGRLDRPT 363 Query: 360 DGYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNS 419 G+F+ PT+F + MTI ++E+F PV SVIRVK+ +EA+ +AN +++ + + T++ Sbjct: 364 RGWFLAPTLFTETSNAMTINREEVFGPVASVIRVKDYEEALHVANDTDYGLSSGIITNSM 423 Query: 420 NAIRYFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYT 472 R+F+ NI AGM +NL PF G K S +G G+ +++FYT Sbjct: 424 KHARHFQANIQAGMTMLNLPTAGVDYHVPFGGRKMSSYGP-REQGRSAIEFYT 475 Lambda K H 0.318 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 530 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 484 Length adjustment: 34 Effective length of query: 453 Effective length of database: 450 Effective search space: 203850 Effective search space used: 203850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory