Align ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)
to candidate AZOBR_RS00060 AZOBR_RS00060 sn-glycerol-3-phosphate ABC transporter ATP-binding protein
Query= reanno::WCS417:GFF4321 (386 letters) >FitnessBrowser__azobra:AZOBR_RS00060 Length = 357 Score = 343 bits (879), Expect = 6e-99 Identities = 187/366 (51%), Positives = 249/366 (68%), Gaps = 12/366 (3%) Query: 1 MATLELRNVNKTYGAGLPDTLKNIELSIKEGEFLILVGPSGCGKSTLMNCIAGLETITGG 60 MAT++L V K+YGA + +K I++S+ +GEFL+L+GPSGCGKSTL+ +AGLE+ITGG Sbjct: 1 MATVDLNQVRKSYGA--VEAIKGIDISVADGEFLVLLGPSGCGKSTLLRMVAGLESITGG 58 Query: 61 AIMIGDQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKMPQADIDAEVARVA 120 I IG + V+G+ PKDRDIAMVFQ+YALYP MSV +N+ +GLKIR +P+A+I A VA+ A Sbjct: 59 EIAIGGRVVNGLEPKDRDIAMVFQNYALYPHMSVFDNMAYGLKIRGLPKAEIQARVAKAA 118 Query: 121 KLLQIEHLLNRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 ++L++ L+R+P QLSGGQ+QRVAMGRA+ R P +LFDEPLSNLDAKLR +MR E+K Sbjct: 119 EILELNRFLDRRPSQLSGGQRQRVAMGRAIVREPAAFLFDEPLSNLDAKLRTQMRVEIKR 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKEIYNNPANQFVASFIGSPP 240 + RL T++YVTHDQ+EAMTL D++ VM G+ +Q GTP E+Y PA+ FVA FIGSPP Sbjct: 179 LQDRLGITSLYVTHDQVEAMTLADRILVMNHGVAEQVGTPLEVYQRPASLFVAGFIGSPP 238 Query: 241 MNFVPLRLQRKDGRLVALLDSGQARCELALNTTEAGLEDRDVILGLRPEQIMLAAGEGDS 300 MN + R G+ VA L G A L + R V LG+RPE + + G G Sbjct: 239 MNVLDARFDGA-GQAVA-LPGGTA---FLLPRPRPDMAGRPVKLGVRPEHLAVTPGHG-- 291 Query: 301 ASSIRAEVQVTEPTGPDTLVFVQLNDTK-VCCRLAPDVAPQVGETLTLQFDPSKVLLFDA 359 + V E G DT+V+ +L D + + R+A + GETL + P + LFDA Sbjct: 292 --PLIVTVDXVEALGADTVVYGRLPDGEGMVVRVAGLPFCREGETLRVGAPPDALHLFDA 349 Query: 360 NTGERL 365 TG RL Sbjct: 350 ETGRRL 355 Lambda K H 0.318 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 357 Length adjustment: 30 Effective length of query: 356 Effective length of database: 327 Effective search space: 116412 Effective search space used: 116412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory