Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate GFF305 Psest_0306 adenosylmethionine-8-amino-7-oxononanoate transaminase
Query= BRENDA::Q9I6J2 (456 letters) >FitnessBrowser__psRCH2:GFF305 Length = 467 Score = 216 bits (550), Expect = 1e-60 Identities = 134/431 (31%), Positives = 214/431 (49%), Gaps = 9/431 (2%) Query: 24 PFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMR 83 P T K + I + +GV++ D +G + LDA++ W G+ + Q Q+ Sbjct: 18 PCTQMKDHEQLPLIPIRRGDGVWLEDFDGKRYLDAVSSWWVNVFGHANPRINQRIKDQVD 77 Query: 84 ELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQ 143 +L + + +H PVVEL++ + + P G++ VF+T +GS + L+M HYW G+ Sbjct: 78 QLE-HVMLAGFSHQPVVELSERLVALTPAGLDRVFYTDNGSTGIEVALKMSFHYWRNSGR 136 Query: 144 PQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEF 203 QK+ + N YHG TVA +S+G + + + + P Y +S +E Sbjct: 137 GQKQRFVTLTNSYHGETVAAMSVGDVALFTDTYKPLLLDTFKVPSPDCYLRPDGVSWEEH 196 Query: 204 GVWAAEQLEKKILEVGEENVAAFIAEP-IQGAGGVIVPPDTYWPKIREILAKYDILFIAD 262 +E+ + E +++AA I EP IQGAGG+ + Y +RE +Y++ I D Sbjct: 197 SRQMFAHMEQTLAE-HHQDIAAVIVEPLIQGAGGMRMYHPVYLKLLREACDRYEVHLIHD 255 Query: 263 EVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQG----GE 318 E+ GFGRTG F + G PD + ++K LT GY+PM V+ D I + Sbjct: 256 EIAVGFGRTGTMFACEQAGITPDFLCLSKALTGGYLPMAAVLTTDRIYQAFYDDYSTLRA 315 Query: 319 FYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGV 378 F H TY+G+P+A A AL + I E+ +IE K A + L DHP V E R Sbjct: 316 FLHSHTYTGNPLACAAALATLDIFAEDNVIEANK-PLAARMASATAHLVDHPHVAEVRQT 374 Query: 379 GMVAALELVKNKKTRERFT-DKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQID 437 GM A+E+V++K +R + + G+ +H G ++R +G + PP I QID Sbjct: 375 GMALAIEMVQDKASRTAYPWQERRGLKVYQHALERGALLRPLGSVVYFLPPYCITEEQID 434 Query: 438 ELITLARKCLD 448 L +A + +D Sbjct: 435 FLAAVATEGID 445 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 467 Length adjustment: 33 Effective length of query: 423 Effective length of database: 434 Effective search space: 183582 Effective search space used: 183582 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory