Align Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale)
to candidate GFF136 Psest_0136 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= uniprot:B2TBJ7 (240 letters) >FitnessBrowser__psRCH2:GFF136 Length = 229 Score = 85.1 bits (209), Expect = 1e-21 Identities = 62/203 (30%), Positives = 98/203 (48%), Gaps = 7/203 (3%) Query: 28 LTLAALAVGAVFGALVAA----AKLSRFRTLRVIGDIYTTVFRGVPELLVIYLFYFGGST 83 LTL + V + G +VA A+ SR +R + Y FRG P L+ ++L Y+G + Sbjct: 19 LTLQLVGVSVIAGLIVAVPLGIARSSRHLAVRALPYGYIFFFRGTPLLVQLFLVYYGMAQ 78 Query: 84 LVTSVGQLFGAEGFVGVPPFVVGALAVGMISGAYQAEVYRSAVLAVSRGELEAARSIGMP 143 V + ++ P+ + + + + AY AE+ R A+ V GE+EAAR++GM Sbjct: 79 F--DVVRQSALWPYLR-DPYWCAIITMTLHTAAYIAEIIRGAIQNVPHGEIEAARALGMS 135 Query: 144 TLTMARRILIPQVLRFALPGIGNVWQLSLKDSALISVTGLAELLRTSQVAAGSTHQYFTF 203 I++P+ R LP N L LK SAL S L EL ++ A T+ + Sbjct: 136 RSQALLHIILPRATRIGLPAYSNEVILMLKASALASTITLLELTGMARKIAARTYLHEEM 195 Query: 204 FVVGGALYLIMTSISNRVFNRAE 226 F+ G +YL++ I + F E Sbjct: 196 FLTAGLIYLLIAFILMQGFKLLE 218 Lambda K H 0.327 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 88 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 229 Length adjustment: 23 Effective length of query: 217 Effective length of database: 206 Effective search space: 44702 Effective search space used: 44702 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory