Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate GFF2603 Psest_2653 fatty oxidation complex, beta subunit FadA
Query= BRENDA::Q0K368 (391 letters) >FitnessBrowser__psRCH2:GFF2603 Length = 391 Score = 244 bits (623), Expect = 3e-69 Identities = 159/397 (40%), Positives = 224/397 (56%), Gaps = 20/397 (5%) Query: 3 EAYIVAAVRTAGGR-KGGKLSGWHPADLAAQVLDALVERTGA-DPALVEDVIMGCVSQVG 60 +A IV RT GR KGG ++A ++D ++ R DPA VEDVI GCV+Q Sbjct: 7 DAVIVDFGRTPMGRSKGGMHRNTRAETMSAHLIDGVLARNPKIDPAEVEDVIWGCVNQTL 66 Query: 61 EQAGNVARNAILASRLPESVPGTSVDRQCGSSQQALHFAAQAVMSGAMDIVIAAGVESMT 120 EQ N+AR A L +R+P + G +V R CGSS ALH A QA+ + D+ + GVE M Sbjct: 67 EQGWNIARMASLMTRIPHTSAGQTVSRLCGSSMSALHTAVQAIQTNNGDVFVIGGVEHMG 126 Query: 121 RVPMGLSSQLPAKNGFGVPKSPGIEARYPGVQFSQFTGAEMIARKYDLSREQLDAYALQS 180 V M GV +P + AEM+ + + ++REQ DA+ +S Sbjct: 127 HVSMM----------HGVDPNPQLSLYAAKASGMMGLTAEMLGKMHGITREQQDAFGERS 176 Query: 181 HQRAIAATKSGRFTAEILPVEVRTADGANGEMHTTDEGVRYDATLESIGSVK--LIAEGG 238 H+ A AT G F EI+P+E DG ++ DE +R D TLES+ ++K +GG Sbjct: 177 HRLAHKATLEGNFKDEIIPMEGYDEDGFL-KVFDYDETIRPDTTLESLAALKPAFNPKGG 235 Query: 239 RVTAASASQICDGAAGLMVVNEAGLKKLGVKPLARVHAMTVIGHDPVVMLEAPLPATEVA 298 VTA ++SQI DGA+ ++V++ K LG++PLA V AM + G DP +M P+P+T+ Sbjct: 236 TVTAGTSSQITDGASCMIVMSAQRAKDLGIQPLAVVRAMALAGVDPAIMGYGPVPSTQKV 295 Query: 299 LKKAGLRIGDIDLFEVNEAFA----PVPLAWLKATGADPARLNVHGGAIALGHPLGGSGA 354 LK+AGL + DI E+NEAFA PV L LK ++N+HGGAIALGHP G SGA Sbjct: 296 LKRAGLTMDDISHVELNEAFAAQALPV-LKDLKLLDKMEEKVNLHGGAIALGHPFGCSGA 354 Query: 355 KLMTTLVHALHTHGKRYGLQTMCEGGGLANVTIVERL 391 ++ TL++ + + G+ TMC G G T+ ER+ Sbjct: 355 RISGTLLNVMKQNNGTIGVATMCIGLGQGISTVFERV 391 Lambda K H 0.317 0.132 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 391 Length adjustment: 31 Effective length of query: 360 Effective length of database: 360 Effective search space: 129600 Effective search space used: 129600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory