Align 3-hydroxybutyryl-CoA dehydrogenase; EC 1.1.1.157 (characterized)
to candidate GFF3731 Psest_3800 3-hydroxyacyl-CoA dehydrogenase
Query= CharProtDB::CH_091789 (282 letters) >FitnessBrowser__psRCH2:GFF3731 Length = 508 Score = 207 bits (526), Expect = 5e-58 Identities = 115/280 (41%), Positives = 164/280 (58%), Gaps = 1/280 (0%) Query: 2 KKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKNLSKLVKKGKIEEAT 61 +++ V+GAG MG GIAQ FA G +V L D + E + L F + L + V KG++ A Sbjct: 3 ERIGVVGAGAMGRGIAQLFAGAGKQVWLHDSRSESISDALRFNRELLERGVAKGRLSVAE 62 Query: 62 KVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDNICKPETILASNTSSLSI 121 L R+ L + CDLVIEA VE ++IK+ +F +L+ + + +LA+NTSSLS+ Sbjct: 63 LDATLARMQAAPALADLSGCDLVIEAIVENLEIKQALFVELEALLAEDAVLATNTSSLSV 122 Query: 122 TEVASATKRPDKVIGMHFFNPAPVMKLVEVIRGIATSQETFDAVKETSIAIGKDPVEVAE 181 T +A+A + P +V G HFFNP P+MKLVEV+RG + + + + + G P + Sbjct: 123 TRIAAACRLPGRVAGFHFFNPVPLMKLVEVVRGERSDPQVIQRLVKLAEDAGHFPAITPD 182 Query: 182 APGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANHPMGPLELGDFIGLDICLAI 241 PGF+VN EA ILAEGIA E ID+ ++ G MGP EL D GLDI A+ Sbjct: 183 TPGFLVNHAGRAYSTEAQRILAEGIADAEQIDRILRDGPGFRMGPFELFDLTGLDISHAV 242 Query: 242 MDVLYSE-TGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDY 280 M+ +Y + D +Y P + V AG LGRK+G+G+Y Y Sbjct: 243 MESVYQQFYQDPRYTPSYQAAQRVAAGLLGRKTGQGYYRY 282 Score = 57.8 bits (138), Expect = 5e-13 Identities = 34/99 (34%), Positives = 56/99 (56%), Gaps = 4/99 (4%) Query: 171 AIGKD--PVEVA-EAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANHPMGPL 227 A+G D PVEV ++PGFV R++ ++N I +GIA + +D+A+ L +P GPL Sbjct: 395 ALGSDGVPVEVINDSPGFVSQRVVASIVNLGCEIAQKGIADPQTLDRAVTLALGYPKGPL 454 Query: 228 ELGDFIGLDICLAIMDVLYS-ETGDSKYRPHTLLKKYVR 265 + G LAI+ + G+++YRP L++ V+ Sbjct: 455 GFAEHYGAARILAILQAMQGCYGGEARYRPSPWLRRRVQ 493 Lambda K H 0.319 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 282 Length of database: 508 Length adjustment: 30 Effective length of query: 252 Effective length of database: 478 Effective search space: 120456 Effective search space used: 120456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory