Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate PfGW456L13_1897 Glucose ABC transporter, ATP-binding subunit (EC 3.6.3.-)
Query= reanno::Smeli:SMc04256 (361 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1897 Length = 386 Score = 334 bits (856), Expect = 3e-96 Identities = 178/366 (48%), Positives = 243/366 (66%), Gaps = 6/366 (1%) Query: 1 MTSVSVRDLSLNFGA--VTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDG 58 M ++ +R+++ +G L + L ID GEFL+L+G SGCGKSTL+NCIAGL +S G Sbjct: 1 MATLELRNVNKTYGPGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGG 60 Query: 59 QIFIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRAS 118 I + D +++ PKDR I MVFQSYALYP M+V N++FGLK+ K+P AEI++ V R S Sbjct: 61 AILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVS 120 Query: 119 EILQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKR 178 ++LQI+ LL RKP +LSGGQ+QRVA+GRAL R ++LFDEPLSNLDAKLR E+R E+K Sbjct: 121 KLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 Query: 179 LHQSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPS 238 +HQ LK T +YVTHDQIEA+TL D++AVMK G+IQQ P IYN P NLFVA FIGSP Sbjct: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPP 240 Query: 239 MNFFRGEVEPKDGR--SFVRAGGIAFDVTAYPAHTRLQPGQKVVLGLRPEHVKVDEAR-D 295 MNF ++ KDGR + + +G ++ L+ ++V+LG+RPE + + + Sbjct: 241 MNFIPLRLQRKDGRLLALLDSGQARCELPLGMQDAGLE-DREVILGIRPEQIILANGEAN 299 Query: 296 GEPTHQAVVDIEEPMGADNLLWLTFAGQSMSVRIAGQRRYPPGSTVRLSFDMGVASIFDA 355 G PT +A V + EP G D L+++ + R+A G T+ L FD +FDA Sbjct: 300 GLPTIRAEVQVTEPTGPDTLVFVNLNDTKVCCRLAPDVAPAVGETLTLQFDPAKVLLFDA 359 Query: 356 ESENRL 361 ++ RL Sbjct: 360 KTGERL 365 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 386 Length adjustment: 30 Effective length of query: 331 Effective length of database: 356 Effective search space: 117836 Effective search space used: 117836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory