Align ABC transporter permease subunit; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine transport system permease protein (characterized, see rationale)
to candidate PfGW456L13_384 Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)
Query= uniprot:A0A1N7UBU2 (233 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_384 Length = 242 Score = 319 bits (817), Expect = 3e-92 Identities = 158/228 (69%), Positives = 192/228 (84%) Query: 6 NLHGYGPMLAQGAWMTLKLAFLALALSLALGLIAAAAKLSSAKWLRVPATLYTTLIRSVP 65 +L G+GP+L QG+WMT+KL+FL L +S+ LGLI A+AKLS + LRVPA YTTLIR VP Sbjct: 15 SLKGFGPLLLQGSWMTVKLSFLCLLVSVGLGLIGASAKLSKSALLRVPAQAYTTLIRGVP 74 Query: 66 DLVLILLIFYSLQLWLNDLSEVFGWDYFEIDPFTAGVITLGFIYGAYFTENFRGAILSVP 125 DLVL+LLIFYSLQ WL L+E GWDY EI+PF+AGVITLGFIYGAYFTE FRGAIL+VP Sbjct: 75 DLVLMLLIFYSLQTWLTSLTEALGWDYIEINPFSAGVITLGFIYGAYFTETFRGAILAVP 134 Query: 126 VGQLEAATAYGLSRWQRFHLVLFPQLMRFALPGLGNNWLVLLKSTALVSIIGLSDLVKAA 185 GQ+EAATAYGL+R QRF LV+FPQ+MRFALPG+GNNW+V+LK+TALVSIIGL+DLVK A Sbjct: 135 RGQMEAATAYGLTRAQRFRLVVFPQMMRFALPGIGNNWMVILKATALVSIIGLADLVKVA 194 Query: 186 QNAGKTTNEPLYFLILAGLMYLVITTLSNRVLKRLERRYNLGIKGMAR 233 Q+AGK++ + +FLILA L+YLVITT+SN VL+R+E Y G + R Sbjct: 195 QDAGKSSYQLFFFLILAALIYLVITTVSNYVLRRMEIFYAAGTREAVR 242 Lambda K H 0.327 0.141 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 242 Length adjustment: 23 Effective length of query: 210 Effective length of database: 219 Effective search space: 45990 Effective search space used: 45990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory