Align ABC transporter related; Flags: Precursor (characterized, see rationale)
to candidate PfGW456L13_3911 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)
Query= uniprot:B2T9V9 (510 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_3911 Length = 517 Score = 266 bits (680), Expect = 1e-75 Identities = 169/480 (35%), Positives = 259/480 (53%), Gaps = 15/480 (3%) Query: 30 LNDVSIRVMPGESHALVGRNGAGKSTLVSILTGLRKPDTGEVRFSGAAAPSIADRDAWRE 89 L + + +M GE AL G NGAGKSTL I+ GL P TG++++ G + A Sbjct: 24 LAGIDLTLMRGEVLALTGENGAGKSTLSKIIGGLVTPTTGQMQYQGQDYRPGSRAQAEAL 83 Query: 90 RVACVYQHSTIIRDLSVAENLFINRQPLRGGVIDWQAMRRDARALLDHWKID-VREDARA 148 + V Q ++ LSVAENLF++ P +GG I + +R+ A + H +D + D Sbjct: 84 GIRMVMQELNLLPTLSVAENLFLDNLPSKGGWISRKQLRKAAIEAMAHVGLDAIDPDTLV 143 Query: 149 GDLSVEARQLVEIARALSYGARFIILDEPTAQLDGDEIKRLFRRISELQREGVTFLFISH 208 G+L + +Q+VEIAR L +ILDEPTA L E++ LF +I+ LQ GV+ ++ISH Sbjct: 144 GELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTAREVEMLFEQITRLQSRGVSIIYISH 203 Query: 209 HLQEVYEICQAVTVLRDARHIVSAPVSALPREQLIEAMTGERGGLAVADAAARGALPADT 268 L+E+ + Q + VLRD + P++ EQL+ M G G + A + P T Sbjct: 204 RLEELARVAQRIAVLRDGNLVCVEPMANYNSEQLVTLMVGRELGEHIDMGARKIGAPVLT 263 Query: 269 AVALELKELTGADYEGVSFTVKRGEVVGLTGATSSGRTSVAEAIAGLRAAKRGTISVDGA 328 L + VSF V+ GE+ G++G +GRT + I G A GTI++ Sbjct: 264 VNGLSRSDKV----RDVSFEVRAGEIFGISGLIGAGRTELLRLIFGADIADSGTIALGAP 319 Query: 329 -----ILPPGDVPASLAHGIGCVPKDRHHEGLVLTQSVAENASMTIARVLGKFGIAAPAK 383 + P D ++ HGI + +DR EGL+LTQS+ N ++ + G K Sbjct: 320 AQVINVRSPVD---AVGHGIALITEDRKGEGLLLTQSIGANIALGNMPGISGAGFVDNDK 376 Query: 384 KNAFGQKMIDALGIVAQGPEHVVSGLSGGNQQKVVMARALATNPNVLVLIDPTAGVDVKS 443 + A Q+ IDA+ I + GP +VS LSGGNQQKVV+ R L + +VL+ +PT G+DV + Sbjct: 377 ERALAQRQIDAMRIRSSGPAQLVSELSGGNQQKVVIGRWLERDCSVLLFDEPTRGIDVGA 436 Query: 444 KEALLSVVDRVREEGKAVLVVSGELDDLR-TCDRVLVMFRGRVAAEFPA-GWQDHDLIAS 501 K + +++ + +GKA++VVS +L +L CDR+ V+ G + F W +L+A+ Sbjct: 437 KFDIYNLLGELTRQGKALVVVSSDLRELMLICDRIGVLSAGSLIDTFDRDSWTQDELLAA 496 Lambda K H 0.318 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 619 Number of extensions: 39 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 510 Length of database: 517 Length adjustment: 35 Effective length of query: 475 Effective length of database: 482 Effective search space: 228950 Effective search space used: 228950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory