Align TreV, component of Trehalose porter (characterized)
to candidate PfGW456L13_1897 Glucose ABC transporter, ATP-binding subunit (EC 3.6.3.-)
Query= TCDB::Q97ZC0 (324 letters) >FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1897 Length = 386 Score = 247 bits (631), Expect = 3e-70 Identities = 130/299 (43%), Positives = 188/299 (62%), Gaps = 6/299 (2%) Query: 2 TVELIDIVKKYGKNI--VINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKI 59 T+EL ++ K YG + + I KI+ GEF +++GPSG GKSTL+ +AG+E + G I Sbjct: 3 TLELRNVNKTYGPGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGGAI 62 Query: 60 IADGADITDKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKL 119 + D ADI+ P+ R++AMVFQ+YALYP MSVRDNIAF LK+R M EI E V + +KL Sbjct: 63 LVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVSKL 122 Query: 120 LGISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQ 179 L I +L +K Q+SGGQQQRVA+ RA+ R P +L DEPLSNLDA++R R E+K + Sbjct: 123 LQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMH 182 Query: 180 KELKGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFPMN 239 + LK T +YVTHDQ EA++L D++A++ G +Q PK +Y P +VA F+G PMN Sbjct: 183 QRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPPMN 242 Query: 240 FLPGELMKEKAQEIGFRPEWVEVGKGNLSCMVESVEASGESRYLICNFKNNNITILSQE 298 F+P L ++ + + ++ G+ + +A E R +I + I + + E Sbjct: 243 FIPLRLQRKDGRLLAL----LDSGQARCELPLGMQDAGLEDREVILGIRPEQIILANGE 297 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 386 Length adjustment: 29 Effective length of query: 295 Effective length of database: 357 Effective search space: 105315 Effective search space used: 105315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory