GapMind for catabolism of small carbon sources

 

Protein Pf1N1B4_6033 in Pseudomonas fluorescens FW300-N1B4

Annotation: FitnessBrowser__pseudo1_N1B4:Pf1N1B4_6033

Length: 325 amino acids

Source: pseudo1_N1B4 in FitnessBrowser

Candidate for 22 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-ribose catabolism rbsC hi ABC transporter permease (characterized, see rationale) 100% 100% 610.5 Erythritol permease, component of ABC transporter, component of The erythritol uptake permease, EryEFG (Yost et al., 2006) (probably orthologous to 3.A.1.2.11) 39% 196.4
L-fucose catabolism HSERO_RS05255 med ABC-type sugar transport system, permease component protein (characterized, see rationale) 39% 95% 211.8 Ribose import permease protein RbsC 37% 198.7
D-fructose catabolism frcC med Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 41% 91% 205.3 Ribose import permease protein RbsC 37% 198.7
sucrose catabolism frcC med Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 41% 91% 205.3 Ribose import permease protein RbsC 37% 198.7
myo-inositol catabolism PS417_11895 med Inositol transport system permease protein (characterized) 41% 82% 179.9 Ribose import permease protein RbsC 37% 198.7
D-mannose catabolism HSERO_RS03645 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 37% 87% 188 Ribose import permease protein RbsC 37% 198.7
xylitol catabolism PS417_12060 lo ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale) 37% 92% 186.8 Ribose import permease protein RbsC 37% 198.7
myo-inositol catabolism iatP lo Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized) 38% 91% 179.5 Ribose import permease protein RbsC 37% 198.7
D-cellobiose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 174.9 Ribose import permease protein RbsC 37% 198.7
D-glucose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 174.9 Ribose import permease protein RbsC 37% 198.7
lactose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 174.9 Ribose import permease protein RbsC 37% 198.7
D-maltose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 174.9 Ribose import permease protein RbsC 37% 198.7
sucrose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 174.9 Ribose import permease protein RbsC 37% 198.7
trehalose catabolism mglC lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 174.9 Ribose import permease protein RbsC 37% 198.7
D-xylose catabolism xylH lo Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 35% 96% 174.9 Ribose import permease protein RbsC 37% 198.7
D-galactose catabolism BPHYT_RS16925 lo Monosaccharide-transporting ATPase; EC 3.6.3.17 (characterized, see rationale) 31% 90% 154.5 Ribose import permease protein RbsC 37% 198.7
D-fructose catabolism fruF lo Fructose import permease protein FruF (characterized) 32% 85% 149.4 Ribose import permease protein RbsC 37% 198.7
sucrose catabolism fruF lo Fructose import permease protein FruF (characterized) 32% 85% 149.4 Ribose import permease protein RbsC 37% 198.7
D-galactose catabolism ytfT lo Galactofuranose transporter permease protein YtfT (characterized) 31% 88% 139.8 Ribose import permease protein RbsC 37% 198.7
L-arabinose catabolism araWsh lo Inner-membrane translocator (characterized, see rationale) 31% 80% 138.3 Ribose import permease protein RbsC 37% 198.7
L-arabinose catabolism araZsh lo Inner-membrane translocator (characterized, see rationale) 30% 97% 127.1 Ribose import permease protein RbsC 37% 198.7
D-galactose catabolism yjtF lo Inner membrane ABC transporter permease protein YjfF (characterized) 32% 86% 122.5 Ribose import permease protein RbsC 37% 198.7

Sequence Analysis Tools

View Pf1N1B4_6033 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNTASLAGKRSGNFYGLGTYLGLAGALLAMVALFSVLSSHFLSYDTFSTLANQIPDLMVL
AVGMTFVLIIGGIDLSVGSVLALAASAVSVAILGWGWSVLPAALLGMAVAALAGTITGSI
TVAWRIPSFIVSLGVLEMARGLAYQMTGSRTAYIGDAFAWLSNPIAFGISPSFIIALLII
FIAQAVLTRTVFGRYLIGIGTNEEAVRLAGINPKPYKILVFSLMGLLAGIAALFQISRLE
AADPNAGSGLELQVIAAVVIGGTSLMGGRGSVISTFFGVLIISVLAAGLAQIGATEPTKR
IITGAVIVVAVVLDTYRSQRASRRT

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory