Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate Pf1N1B4_4763 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43)
Query= SwissProt::Q9C4M5 (331 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4763 Length = 341 Score = 248 bits (634), Expect = 1e-70 Identities = 136/269 (50%), Positives = 175/269 (65%), Gaps = 6/269 (2%) Query: 56 KVDKELLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAV 115 K+D LL+ AP L+ IA +VG DN DI+ T+R I ++NTP VLT+ TAD FAL+LA Sbjct: 55 KLDAGLLDLAPNLEAIASVSVGVDNYDIDYLTERRILLSNTPDVLTETTADTGFALILAT 114 Query: 116 ARRIVEADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAK-GFGM 174 ARR+VE VR+G+W ++ H G + GKTLGI+G GRIG+ALA+R GFGM Sbjct: 115 ARRVVELANMVRAGQWNRNIGPTH----FGSDVHGKTLGIIGMGRIGEALAQRGHFGFGM 170 Query: 175 KIIYYSRTRKPEAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNA 234 ++Y+S + KP E+ A+Y LL+++DF+ L +PLT T +IG ++ LM+P Sbjct: 171 PVVYHSHSPKPAVEQRFNAQYRSLSDLLQQADFVCLTLPLTAATEGLIGAEQFALMRPET 230 Query: 235 ILINTSRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEE-LFKLKNVVLAPHIGSAT 293 I IN SRG VVD ALI+AL+ I AGLDVFE EP N+ L +L NVV PHIGSAT Sbjct: 231 IFINISRGKVVDEPALIEALRHKRIRAAGLDVFEREPLGNDSPLLQLNNVVATPHIGSAT 290 Query: 294 HEAREGMAELVAKNLIAFAKGEIPPNLVN 322 HE RE MA NL+A GE P NLVN Sbjct: 291 HETREAMARCAVDNLLAALAGERPANLVN 319 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 341 Length adjustment: 28 Effective length of query: 303 Effective length of database: 313 Effective search space: 94839 Effective search space used: 94839 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory