Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate Pf1N1B4_5115 Maltose/maltodextrin transport ATP-binding protein MalK (EC 3.6.3.19)
Query= uniprot:D4GP39 (383 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5115 Length = 381 Score = 280 bits (716), Expect = 5e-80 Identities = 158/363 (43%), Positives = 225/363 (61%), Gaps = 16/363 (4%) Query: 3 RLTLDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTE 62 +L LD+V K G + + ++SL+I GEF+V VGPSGCGKST LR++AGL+++ Sbjct: 3 KLKLDNVNKQL-----GGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICG 57 Query: 63 GELRLEDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVEE 122 G+L ++ R +N + ++R + MVFQSYALYPH SV N+SFGL+ + +R+RV + Sbjct: 58 GDLLIDGRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAK-TDKTSLRERVLK 116 Query: 123 TTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTEL 182 T +L + LL RKP +LSGGQ+QRVA+GRA+ R+P++ L DEPLSNLDA LR +MR E+ Sbjct: 117 TAQILQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEI 176 Query: 183 QRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFIGE 242 RL LG T +YVTHDQ EAMT+ D++ VL+ G ++QVG+P + Y RP + FVAGF+G Sbjct: 177 ARLHDRLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGS 236 Query: 243 PSMNLFDGSLS--GDTFRGDGFDYPLSGATRDQLGGASG--LTLGIRPEDVTVGERRSGQ 298 P MN L G+T D + ++ D A+G L+LGIRPE V++ ++ Sbjct: 237 PRMNFLSARLQTPGETSLVDTLVWGITSLPFDSSNLAAGTPLSLGIRPEHVSL---KAAD 293 Query: 299 RTFDAEVVVVEPQGNENAVHLRFVDGDEGTQFTATTTGQSRVEAGDRTTVSFPEDAIHLF 358 T V VE G+E VHL + + + +AGDR + D +HLF Sbjct: 294 GTAGVVVTAVEYLGSETYVHL---ETGQDEPLICRCEVSAGWQAGDRVELLLDLDNLHLF 350 Query: 359 DGE 361 D + Sbjct: 351 DAD 353 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 381 Length adjustment: 30 Effective length of query: 353 Effective length of database: 351 Effective search space: 123903 Effective search space used: 123903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory