Align gluconolactonase (EC 3.1.1.17) (characterized)
to candidate Pf1N1B4_4510 Gluconolactonase (EC 3.1.1.17)
Query= BRENDA::Q15493 (299 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4510 Length = 297 Score = 133 bits (334), Expect = 6e-36 Identities = 94/298 (31%), Positives = 145/298 (48%), Gaps = 19/298 (6%) Query: 4 IKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVAL 63 +++E ++ GESPVW N+L +VDIP + RW++ + V ++ +A Sbjct: 1 MQVELIVDARNAVGESPVWVPEENALYWVDIPTGGLQRWNADSGHVHAWKAPQMLACIAR 60 Query: 64 RQSGGYVATIGTKFCALNWKEQSAV---VLATVDNDKKNNRFNDGKVDPAGRYFAGTMA- 119 +GG+VA + + F L+ ++ +LA VD+ + + R NDG+ D GR++AG+M Sbjct: 61 HSAGGWVAGMESGFFHLHPHNDGSLDSELLAHVDHARPDMRLNDGRCDRQGRFWAGSMVL 120 Query: 120 ---EETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLS--YS 174 A L R YS + + NGL +S D K Y DS Sbjct: 121 NMGANAADGTLYR-----YSARQPGPLDARLSGFIVPNGLGFSPDGKTMYLSDSHPNVQQ 175 Query: 175 VDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKR 234 + AFDYD+ +G SNRR + PDG +DAEG W+ + G + R P G+ Sbjct: 176 IWAFDYDIDSGTPSNRRLFVDMHHFLGRPDGAAVDAEGCYWICANDAGLIHRFTP-DGRL 234 Query: 235 LQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGI 292 +++ +PV K T C FGG ++VT R D + Q AGG+F + GVKG+ Sbjct: 235 DRSLPVPVKKPTMCAFGGSQLDTLFVTSIRPADDHD---EQSLAGGVFALNP-GVKGL 288 Lambda K H 0.319 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 297 Length adjustment: 27 Effective length of query: 272 Effective length of database: 270 Effective search space: 73440 Effective search space used: 73440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory