Align ABC transporter for L-Fucose, ATPase component (characterized)
to candidate Pf1N1B4_5115 Maltose/maltodextrin transport ATP-binding protein MalK (EC 3.6.3.19)
Query= reanno::Smeli:SM_b21106 (365 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5115 Length = 381 Score = 310 bits (794), Expect = 4e-89 Identities = 171/358 (47%), Positives = 231/358 (64%), Gaps = 15/358 (4%) Query: 6 LKKLVKRYGALEVVHGIDLEVKDREFIALVGPSGCGKSTTLRMIAGLEEVSGGAIEIGGR 65 L + K+ G + ++ + LE+ EF+ VGPSGCGKST LR+IAGL+ + GG + I GR Sbjct: 6 LDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGR 65 Query: 66 KVNDLPPRARNISMVFQSYALYPHMTVAENMGFSLKIAGRPAEEIKTRVAEAAAILDLAH 125 +VNDL PR R + MVFQSYALYPHM+V +N+ F LK+A ++ RV + A IL L Sbjct: 66 RVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQILQLDK 125 Query: 126 LLERRPSQLSGGQRQRVAMGRAIVRQPDVFLFDEPLSNLDAKLRTQVRTEIKKLHARMQA 185 LL+R+P +LSGGQRQRVAMGRA+ R+PD+ LFDEPLSNLDA LR Q+R EI +LH R+ + Sbjct: 126 LLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHDRLGS 185 Query: 186 TMIYVTHDQVEAMTLSDRIVIMRDGHIEQVGTPEDVFRRPATKFVAGFIGSPPMNMEEAV 245 TMIYVTHDQVEAMTL+D+IV++ G +EQVG+P +++ RPA++FVAGF+GSP MN A Sbjct: 186 TMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSPRMNFLSAR 245 Query: 246 L-TDGKLAFASGATLPLP--PRFRSLVREGQKVTFGLRPDDVYPSGHGLHAGDADAVHEI 302 L T G+ + + P S + G ++ G+RP+ V L A D A Sbjct: 246 LQTPGETSLVDTLVWGITSLPFDSSNLAAGTPLSLGIRPEHV-----SLKAADGTA---- 296 Query: 303 ELPVTITEPLGNETLVFTQFNGRD--WVSRMLNPRPLRPGEAVPMSFDLARAHLFDGE 358 + VT E LG+ET V + G+D + R + G+ V + DL HLFD + Sbjct: 297 GVVVTAVEYLGSETYVHLE-TGQDEPLICRCEVSAGWQAGDRVELLLDLDNLHLFDAD 353 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 381 Length adjustment: 30 Effective length of query: 335 Effective length of database: 351 Effective search space: 117585 Effective search space used: 117585 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory