Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate Pf1N1B4_2638 UDP-glucose 4-epimerase (EC 5.1.3.2)
Query= BRENDA::F2NQX6 (314 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2638 Length = 309 Score = 209 bits (531), Expect = 9e-59 Identities = 126/306 (41%), Positives = 178/306 (58%), Gaps = 11/306 (3%) Query: 3 VLVTGGAGFIGSHLVHALHQKGIPVAVLDDLSTGKRAHIPPDVPLYQTDIRDL-NAVLHA 61 VL+TGGAGFIGSHL AL KG V +LDDLSTGKR+++P D PL + + D+ +A L A Sbjct: 6 VLITGGAGFIGSHLTDALLAKGHSVRILDDLSTGKRSNLPLDNPLVELIVGDVADAALVA 65 Query: 62 FQDFQPTHVAHQAAQASVKHSVQNPCKDAEINLLGGLNILEAMRATGTQKIVFASTGGAI 121 + VAH AA ASV+ SV +P K + N +G LN+ EAMR TG ++++FAS+ A+ Sbjct: 66 QAMVGCSAVAHLAAVASVQASVDDPVKTHQSNFIGSLNVCEAMRQTGVKRVLFASSA-AV 124 Query: 122 YGEVPEGRRAPETWPPKPKSPYAASKAAFEHYLEVYRQTHGLTYTTLRYANVYGPRQDPH 181 YG EG E P P +PYAA K A EHY + YR+ H L R+ N++GPRQDP Sbjct: 125 YGNNGEGESIDEDTPKAPLTPYAADKLASEHYFDFYRRQHSLEPVIFRFFNIFGPRQDPS 184 Query: 182 GE-AGVVAIFTNRLLHAQPVTLYARKEPGDPGCIRDYIHVEDVTRANLLALE-TNLE-GT 238 +GV++IF+ R P+T++ GD RD+++VED+ + A+E +E G Sbjct: 185 SPYSGVISIFSERAQKGLPITVF-----GDGEQTRDFVYVEDLVGVLVQAIEKPQVEVGA 239 Query: 239 YNVSTGQGRTTEDVLYTIARALGTTPRVTYAPPRDGDLEVSVLDPTQ-LQAHGWRPQVPF 297 NV Q T + +L + +G P V+Y P R GD+ S + + L+ + Q P Sbjct: 240 VNVGWNQATTLKQMLEALEAVVGELPPVSYGPARSGDIRHSRANNRRLLERFTYPQQTPM 299 Query: 298 EEGIRR 303 G+ R Sbjct: 300 SVGLAR 305 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 309 Length adjustment: 27 Effective length of query: 287 Effective length of database: 282 Effective search space: 80934 Effective search space used: 80934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory