Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate Pf1N1B4_5885 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)
Query= BRENDA::P9WN67 (314 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5885 Length = 352 Score = 149 bits (376), Expect = 1e-40 Identities = 105/335 (31%), Positives = 165/335 (49%), Gaps = 30/335 (8%) Query: 1 MRALVTGAAGFIGSTLVDRLLADGHSVVGLDNFATGRATNLEH----LADNSAHVFVEAD 56 M+ LVTGAAGFIG+ + RLL DGH V GLDNF L+H F A Sbjct: 1 MKILVTGAAGFIGAHCLLRLLRDGHEVCGLDNFNDFYDPQLKHDRVDWVRKQVGDFQLAK 60 Query: 57 IVTAD---LHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAARQTGV 113 + AD L A+ +PEVV HLAAQ VR S+ +P+ N+ G + + E+ R V Sbjct: 61 VDVADATALDALFVAEQPEVVIHLAAQAGVRYSLENPRAYVDSNLSGFLNILESCRHHPV 120 Query: 114 RKIVHTSSGGSIYGTPPEYPTPETAPTD-PASPYAAGKVAGEIYLNTFRHLYGLDCSHIA 172 + +++ SS S+YG P D P S YAA K A E+ +++ HL+G+ C+ + Sbjct: 121 KHLIYASS-SSVYGANQHTPYSVKDGVDHPLSLYAATKKANELMAHSYSHLFGIPCTGLR 179 Query: 173 PANVYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRV---- 228 VYGP P FA+A+ G+P ++F G + RD+ ++DD+V++ R+ Sbjct: 180 FFTVYGPWGRPDMSP---IQFARAIAEGQPLKLFNYGQHQRDFTYIDDIVESIARLIERA 236 Query: 229 --------------SADVGGGLRFNIGTGKETSDRQLHSAVAAAVGGPDDPEFHPPRLGD 274 ++ + +NIG + + + + +G E P + GD Sbjct: 237 PQPAPQWNREQPDPASSMAPWRIYNIGGQQPVELKDYLALLEKHLGQKALVELLPLQPGD 296 Query: 275 LKRSCLDIGLAERVLGWRPQIELADGVRRTVEYFR 309 + +C D + G++P+IEL +G+ R + +FR Sbjct: 297 VLNTCADASDLAQATGFQPRIELDEGLGRFIAWFR 331 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 352 Length adjustment: 28 Effective length of query: 286 Effective length of database: 324 Effective search space: 92664 Effective search space used: 92664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory