Align L-arabinolactonase (EC 3.1.1.15) / D-galactonolactonase (EC 3.1.1.25) (characterized)
to candidate Pf1N1B4_413 L-arabinolactonase (EC 3.1.1.15)
Query= reanno::pseudo5_N2C3_1:AO356_20235 (291 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_413 Length = 314 Score = 526 bits (1354), Expect = e-154 Identities = 248/291 (85%), Positives = 262/291 (90%) Query: 1 MKWTAVTEHRAKLGEGPFWDAPTQALYWVDIAGKQALRLIGANVEIWQMPEHVSAFIPTQ 60 M WTAVT HRA+LGEGPFWDAPTQALYWVDIAGKQALRLIGANVEIWQMPEHVSAFIP + Sbjct: 24 MTWTAVTGHRAQLGEGPFWDAPTQALYWVDIAGKQALRLIGANVEIWQMPEHVSAFIPCE 83 Query: 61 SGDALVTLSSGVYRLDLDSPGLEPRLTLLCMADPQPGNRANEARCDPQGQLWLGTMQNNI 120 SGDALVTLSSGVYRLDL SPGLEPRLTL C+ADPQPGNR NEARCD QG+LWLGTMQNNI Sbjct: 84 SGDALVTLSSGVYRLDLASPGLEPRLTLFCVADPQPGNRPNEARCDAQGRLWLGTMQNNI 143 Query: 121 GAEGEDLPIEHRSGGLFRVGSDGRVLPLLRGLGIPNTLLWSPDGTTVYFGDSLDGTVYRH 180 G +GEDLP+ RSGGLFR+ D RV PLLRGLGIPNTLLWS DGTT+YF DSLD T+YRH Sbjct: 144 GEQGEDLPVVRRSGGLFRIDRDARVTPLLRGLGIPNTLLWSDDGTTLYFADSLDSTLYRH 203 Query: 181 FIYPEGNLAPAEVWFGPHPRGGPDGSAMDARGYIWNARWDGSCLLRLTPDGQVDRVIELP 240 FI+ +GNL A VWFGPH RGGPDGSAMDA GY+WNARWDGSCLLRL PDG VDRVIELP Sbjct: 204 FIHTDGNLDTAYVWFGPHERGGPDGSAMDAEGYVWNARWDGSCLLRLNPDGYVDRVIELP 263 Query: 241 VSRPTSCVFGGEDLKTLYITSAASPLGHPLDGAVLSMRVDVPGVACTRFAG 291 VSRPTSCVFGGED KTLYITSAASPL HPLDGA+LS+RVDVPG AC RFAG Sbjct: 264 VSRPTSCVFGGEDFKTLYITSAASPLNHPLDGALLSIRVDVPGKACQRFAG 314 Lambda K H 0.319 0.140 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 554 Number of extensions: 28 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 314 Length adjustment: 27 Effective length of query: 264 Effective length of database: 287 Effective search space: 75768 Effective search space used: 75768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory