Align GlcU, component of Glucose, mannose, galactose porter (characterized)
to candidate Pf1N1B4_594 Glucose ABC transport system, inner membrane component 2
Query= TCDB::Q97UY9 (287 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_594 Length = 281 Score = 128 bits (321), Expect = 2e-34 Identities = 79/273 (28%), Positives = 137/273 (50%), Gaps = 10/273 (3%) Query: 15 YLALAIVSVIWLIPVYAMLINGFKSNFEVLSTPVLVPPTKITFEAYVSVLLSLAKPLINS 74 Y L + + I+LIP+ ML+ FKS ++ + +L P I ++ S+ NS Sbjct: 18 YATLLLAAAIYLIPLVVMLLTSFKSPEDIRTGNLLSLPQVIDGIGWIKAWDSVGSYFWNS 77 Query: 75 LIIVIPTSFISAFLGAMGAYFFYTLSYSFSRASSAISDVLFSLISLATFIPQEATLLPLT 134 + I +P IS F+GAM Y + S+ + F L+ F+P + LLP + Sbjct: 78 VKITVPAVLISTFIGAMNGYVLSMWRFRGSQ-------LFFGLLLFGCFLPFQTVLLPAS 130 Query: 135 RLIVSMGLLDSYIGIIFALLIFYIPTGALLMSMFISVIPRSLIEAAKMDGTGDLKIFMKI 194 + +GL ++ G++ +++ + L + IP +L++AA++DG G IF KI Sbjct: 131 FTLGKIGLANTTTGLVLVHVVYGLAFTTLFFRNYYVSIPDALVKAARLDGAGFFTIFWKI 190 Query: 195 VFPLSMPGFISTLIFIIIQAWNNFFIPLVLVTTPGMKLT-SIAVLSYSGAYGTLYNDTFA 253 + P+S+P + LI+ Q WN+F +V + +T ++ L + YN A Sbjct: 191 LLPMSIPIVMVCLIWQFTQIWNDFLFGVVFASGDAQPITVALNNLVNTSTGAKEYNVDMA 250 Query: 254 AGMVASIIPLAIFVFLGRYFIRGLMALGGGGKG 286 A M+A + L +++F G+YF+RGL + G KG Sbjct: 251 AAMIAGLPTLLVYIFAGKYFLRGLTS--GAVKG 281 Lambda K H 0.330 0.144 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 281 Length adjustment: 26 Effective length of query: 261 Effective length of database: 255 Effective search space: 66555 Effective search space used: 66555 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory