Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate Pf1N1B4_593 Glucose ABC transporter, ATP-binding subunit (EC 3.6.3.-)
Query= reanno::Smeli:SMc02869 (352 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_593 Length = 386 Score = 290 bits (742), Expect = 4e-83 Identities = 151/322 (46%), Positives = 213/322 (66%), Gaps = 33/322 (10%) Query: 17 VGSLQLKTIRKAFGSH--EVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSG 74 + +L+L+ + K +G+ + LK I+L + DGEF+I VGPSGCGKSTL+ IAGLE+ + G Sbjct: 1 MATLELRNVNKTYGAGLPDTLKNIELKINDGEFLILVGPSGCGKSTLMNCIAGLENISGG 60 Query: 75 SVQIDGVEVGHVAPAKRGIAMVFQSYALYPHLTVKDNMGLGLKQAGVPKAEIEEKVAKAA 134 ++ +D ++ ++P R IAMVFQSYALYP ++V+DN+ GLK +P AEI+E+VA+ A Sbjct: 61 AILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVA 120 Query: 135 GMLSLEPYLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIAR 194 +L +E L+R+P +LSGGQ+QRVA+GRA+ R PK++LFDEPLSNLDA LRV R E+ Sbjct: 121 KLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 Query: 195 LHRSLKATMIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIGSPQ 254 +H+ LK T +YVTHDQ+EAMTL DK+ V+ G I+Q G+P ++YN PANLFVA FIGSP Sbjct: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPP 240 Query: 255 MNFIE----------AAKLGDGEAK-----------------TIGIRPEHIGLSRESGDW 287 MNFI A L G+A+ +G+RPE I L+ + Sbjct: 241 MNFIPLRLQRKDGRLVALLDSGQARCELPLGMQDAGLEDREVILGMRPEQIVLAGSEPNG 300 Query: 288 ----KGKVIHVEHLGADTIIYI 305 + +V E G DT++++ Sbjct: 301 LPTIRAEVQVTEPTGPDTLVFV 322 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 386 Length adjustment: 30 Effective length of query: 322 Effective length of database: 356 Effective search space: 114632 Effective search space used: 114632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory