Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate Pf1N1B4_2538 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= reanno::psRCH2:GFF857 (371 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2538 Length = 374 Score = 249 bits (636), Expect = 9e-71 Identities = 132/287 (45%), Positives = 190/287 (66%), Gaps = 10/287 (3%) Query: 4 VTLRDICKSYDGTP-ITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGDLLI 62 V+ R + KSYDG I + ++LDI GEF+ +GPSG GK+T L ++AG E T+G++ + Sbjct: 15 VSFRGVQKSYDGENLIVKDLNLDIRKGEFLTLLGPSGSGKTTSLMMLAGFETPTAGEIQL 74 Query: 63 DNQRVNDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAVAEILQ 122 + +N++PP R +GMVFQ+YAL+PHMTVAEN+AF L + ++K ++ RV+ V ++Q Sbjct: 75 AGRSINNVPPHKRDIGMVFQNYALFPHMTVAENLAFPLTVRGLNKNDVSDRVKRVLSMVQ 134 Query: 123 LDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIARLHQR 182 LD +R P LSGGQ+QRVA+ R +V EP++ L DEPL LD LR M++EI LHQR Sbjct: 135 LDTFAQRYPAQLSGGQQQRVALARALVFEPQLVLMDEPLGALDKQLREHMQMEIKHLHQR 194 Query: 183 IRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGSPQMNFV 242 + T++YVTHDQ EA+T++D++ V + GEI Q+ P LY PKN FVA F+G + N + Sbjct: 195 LGVTVVYVTHDQGEALTMSDRVAVFHQGEIQQIAPPRSLYEEPKNTFVANFIG--ENNRL 252 Query: 243 EVRAISASPETVTIELPSGYPLTLPVDGSAVS---PGDPLTLGIRPE 286 R S + + +EL G V+ AV+ G+P+TL IRPE Sbjct: 253 NGRLHSHTGDRCVVELGRGE----KVEALAVNVGKTGEPVTLSIRPE 295 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 374 Length adjustment: 30 Effective length of query: 341 Effective length of database: 344 Effective search space: 117304 Effective search space used: 117304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory