Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate Pf1N1B4_2538 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2538 Length = 374 Score = 244 bits (624), Expect = 2e-69 Identities = 133/292 (45%), Positives = 174/292 (59%), Gaps = 1/292 (0%) Query: 4 VTFKDASLSYPGAKEPTVKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIF 63 V+F+ SY G + VK NL+I GEFL L+GPSG GK+T+L MLAG E T G I Sbjct: 15 VSFRGVQKSYDG-ENLIVKDLNLDIRKGEFLTLLGPSGSGKTTSLMMLAGFETPTAGEIQ 73 Query: 64 IGDKDVTHVAPRDRDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATL 123 + + + +V P RDI MVFQNYAL+PHMTV EN+ F L + G ++++++ RV + + Sbjct: 74 LAGRSINNVPPHKRDIGMVFQNYALFPHMTVAENLAFPLTVRGLNKNDVSDRVKRVLSMV 133 Query: 124 GLTEFLERKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQR 183 L F +R P LSGGQ+QRVA+ RA+V PQ+ LMDEPL LD +LR + +I L + Sbjct: 134 QLDTFAQRYPAQLSGGQQQRVALARALVFEPQLVLMDEPLGALDKQLREHMQMEIKHLHQ 193 Query: 184 KLGVTTVYVTHDQTEALTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMNL 243 +LGVT VYVTHDQ EALTM DR+AV G +QQ+ PR LY+ P N FVA FIG Sbjct: 194 RLGVTVVYVTHDQGEALTMSDRVAVFHQGEIQQIAPPRSLYEEPKNTFVANFIGENNRLN 253 Query: 244 GTFSVKDGDATSGHARIKLSPETLAAMTPEDNGRITIGFRPEALEIIPEGES 295 G GD E LA + +T+ RPE + + ES Sbjct: 254 GRLHSHTGDRCVVELGRGEKVEALAVNVGKTGEPVTLSIRPERVSLNGSSES 305 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 22 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 374 Length adjustment: 30 Effective length of query: 346 Effective length of database: 344 Effective search space: 119024 Effective search space used: 119024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory