Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate Pf1N1B4_1583 Histidine ABC transporter, ATP-binding protein (TC 3.A.1)
Query= TCDB::Q9KKE1 (275 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1583 Length = 276 Score = 362 bits (930), Expect = e-105 Identities = 178/267 (66%), Positives = 220/267 (82%) Query: 1 MADIEIRNVYKIFGHDAKKALTMVEDGLDKADILSRSGCTVGLNDVSLKIGAGKIFVIMG 60 ++ IE++NV+KIFG+ +K AL M+ K +L+ +GC VG+ND+SL IG G+IFVIMG Sbjct: 6 ISKIEVKNVFKIFGNRSKDALEMIRQKKTKDQVLAETGCVVGVNDLSLSIGTGEIFVIMG 65 Query: 61 LSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAFRMRRVSMVFQSFALMPHR 120 LSGSGKSTLVRH NRLI+PTSG +L DG +IL +ALR FR ++SMVFQSF L+PH+ Sbjct: 66 LSGSGKSTLVRHFNRLIDPTSGAILVDGVDILQYDMEALREFRRHKISMVFQSFGLLPHK 125 Query: 121 TVLQNVVYGQRVRGVSKDDAREIGMKWIDTVGLSGYDAKFPHQLSGGMKQRVGLARALAA 180 TVL NV YG +VRG SK E + WI+TVGL GY+ K+PHQLSGGM+QRVGLARALAA Sbjct: 126 TVLDNVAYGLKVRGESKQMCAERALHWINTVGLKGYENKYPHQLSGGMRQRVGLARALAA 185 Query: 181 DTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFITHDLDEALRIGSEIAILRDG 240 DTD+ILMDEAFSALDPLIR +MQDQLL+LQ+ L KTIVFITHDLDEA+RIG+ IAIL+DG Sbjct: 186 DTDIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIGNRIAILKDG 245 Query: 241 QVVQVGTPNDILDNPANDYVARFVQRR 267 +++QVGTP +IL +PA++YV RFVQRR Sbjct: 246 RLIQVGTPREILHSPADEYVDRFVQRR 272 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 276 Length adjustment: 25 Effective length of query: 250 Effective length of database: 251 Effective search space: 62750 Effective search space used: 62750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory