Align NatB, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate Pf1N1B4_1382 Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)
Query= TCDB::Q8YVY4 (441 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_1382 Length = 377 Score = 106 bits (264), Expect = 1e-27 Identities = 104/343 (30%), Positives = 149/343 (43%), Gaps = 20/343 (5%) Query: 56 LKIGSLLPATGDLASIGQQMAAAVPLVVETVNACGGVNGQPVSLVAVDDQTDPKAGAAGM 115 +KIG P TG A+ G+Q + VNA GGVNG+ + LV DD +PK A + Sbjct: 29 IKIGVAGPMTGANAAFGEQYMKGAQAAADAVNAAGGVNGEKIVLVKGDDACEPKQ-AVTV 87 Query: 116 TKLATVDKVAGVVGSFASSVSTAAVSIAAQNKVLLISPGSTSPVFTEKAQKGDFNGFWAR 175 K T KVAGVVG F SS + A I + ++ I+PGST+P TE+ F R Sbjct: 88 AKDLTNQKVAGVVGHFCSSSTIPASEIYDEAGIIAITPGSTNPAVTERGLSAMF-----R 142 Query: 176 TVPPDSYQGPALAE-LANKKGFKRVSTIVINNDYGVGFEKAFVQAFEKLGGTVVNKNNPV 234 D QG + + + K+V + + YG G A K G T V Sbjct: 143 MCGRDDQQGIVAGDYIVDVLKGKKVVVLHDKDTYGQGLADATKAQLAKRGVTPVLYEGLT 202 Query: 235 RYDPKATTFETEAAAAFAGKPDAVLGVFYVETGSLLLKSAYQQGVAQGVQIMLTDGMKSD 294 R + +T T+ AG G + E G L++ +QG+ + V+ M DG+ +D Sbjct: 203 RGEKDFSTIVTKIRG--AGADVVYFGGLHPEAGP-LVRQLREQGL-KDVKFMSDDGIVTD 258 Query: 295 EFPAQVGKTADGKFIASGIIGTVPGSDGKGLEALTKLWQS--KKGSAPGEFAPQAWDATA 352 E TA G G++ T G+D + L + KKG+ P + A+ + Sbjct: 259 ELVT----TAGGPQFVDGVLMTF-GADPRLLPDSKTVVDDFRKKGTEPEGYTLYAYASVQ 313 Query: 353 LLVLAAQAAKENTGVGIAG--KIRDVSSAPGVEVTDVCEGLKL 393 L A AK N G A K V + G + D LK+ Sbjct: 314 TLAAAFNGAKSNKGEEAAAWLKKNPVKTVMGEKTWDSKGDLKI 356 Lambda K H 0.312 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 377 Length adjustment: 31 Effective length of query: 410 Effective length of database: 346 Effective search space: 141860 Effective search space used: 141860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory