Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate Pf1N1B4_593 Glucose ABC transporter, ATP-binding subunit (EC 3.6.3.-)
Query= reanno::Smeli:SMc03065 (362 letters) >FitnessBrowser__pseudo1_N1B4:Pf1N1B4_593 Length = 386 Score = 278 bits (712), Expect = 1e-79 Identities = 154/362 (42%), Positives = 220/362 (60%), Gaps = 12/362 (3%) Query: 1 MTGLLLKDIRKSYGA--VDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGG 58 M L L+++ K+YGA D + I+L I +GEF++ VGPSGCGKSTL+ IAGLE I+GG Sbjct: 1 MATLELRNVNKTYGAGLPDTLKNIELKINDGEFLILVGPSGCGKSTLMNCIAGLENISGG 60 Query: 59 DMFIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAA 118 + +D ++ + P R IAMVFQSYALYP M+V DN+AFG++I + EID V A Sbjct: 61 AILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVA 120 Query: 119 DMLQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAK 178 +LQ+ L R P LSGGQ+QRVA+GRA+ R PK++LFDEPLSNLDA LRV R E+ Sbjct: 121 KLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 Query: 179 LSERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSP 238 + +R+ TT +YVTHDQ+EAMTL D++ V+ G I+Q G P ++Y PANLFVA FIGSP Sbjct: 181 MHQRLK-TTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSP 239 Query: 239 AMNVIPATITATGQQTAVSLAGGKSVTLDVPTNASENG---KTASFGVRPEDLRVTEADD 295 MN IP + + L G++ ++P + G + G+RPE + + ++ Sbjct: 240 PMNFIPLRLQRKDGRLVALLDSGQA-RCELPLGMQDAGLEDREVILGMRPEQIVLAGSEP 298 Query: 296 F---LFEGTVSIVEALGEVTLLYIEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHL 352 V + E G TL+++ + + + ++ G+ + D +K+ L Sbjct: 299 NGLPTIRAEVQVTEPTGPDTLVFVN--LNDTKVCCRLAPDVAPAVGETLTLQFDPSKVLL 356 Query: 353 FD 354 FD Sbjct: 357 FD 358 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 386 Length adjustment: 30 Effective length of query: 332 Effective length of database: 356 Effective search space: 118192 Effective search space used: 118192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory