GapMind for catabolism of small carbon sources

 

Protein AO353_05965 in Pseudomonas fluorescens FW300-N2E3

Annotation: FitnessBrowser__pseudo3_N2E3:AO353_05965

Length: 466 amino acids

Source: pseudo3_N2E3 in FitnessBrowser

Candidate for 19 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-tryptophan catabolism aroP hi Aromatic amino acid transport protein AroP (characterized, see rationale) 86% 98% 799.7 Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs 59% 564.7
L-tyrosine catabolism aroP hi L-tyrosine transporter (characterized) 73% 99% 708.8 Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs 59% 564.7
phenylacetate catabolism H281DRAFT_04042 med Aromatic amino acid transporter AroP (characterized, see rationale) 67% 98% 634.8 L-tyrosine transporter 73% 708.8
L-phenylalanine catabolism aroP med Aromatic amino acid transport protein AroP (characterized, see rationale) 68% 96% 634.8 L-tyrosine transporter 73% 708.8
L-threonine catabolism RR42_RS28305 med D-serine/D-alanine/glycine transporter (characterized, see rationale) 45% 94% 413.3 L-tyrosine transporter 73% 708.8
D-alanine catabolism cycA med L-alanine and D-alanine permease (characterized) 45% 96% 411.4 L-tyrosine transporter 73% 708.8
L-alanine catabolism cycA med L-alanine and D-alanine permease (characterized) 45% 96% 411.4 L-tyrosine transporter 73% 708.8
L-histidine catabolism permease med histidine permease (characterized) 42% 97% 382.1 L-tyrosine transporter 73% 708.8
L-proline catabolism proY med Proline-specific permease (ProY) (characterized) 43% 99% 375.9 L-tyrosine transporter 73% 708.8
D-serine catabolism cycA med D-serine/D-alanine/glycine transporter (characterized) 40% 95% 359.4 L-tyrosine transporter 73% 708.8
L-serine catabolism serP lo Serine transporter, SerP2 or YdgB, of 459 aas and 12 TMSs (Trip et al. 2013). Transports L-alanine (Km = 20 μM), D-alanine (Km = 38 μM), L-serine, D-serine (Km = 356 μM) and glycine (Noens and Lolkema 2015). The encoding gene is adjacent to the one encoding SerP1 (TC# 2.A.3.1.21) (characterized) 38% 97% 312.4 L-tyrosine transporter 73% 708.8
L-threonine catabolism serP1 lo Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized) 36% 97% 298.5 L-tyrosine transporter 73% 708.8
L-arginine catabolism rocE lo arginine permease (characterized) 36% 80% 269.2 L-tyrosine transporter 73% 708.8
L-lysine catabolism lysP lo Lysine/arginine permease CAN1; Basic amino acids permease CAN1 (characterized) 34% 81% 265 L-tyrosine transporter 73% 708.8
L-asparagine catabolism AGP1 lo general amino acid permease AGP1 (characterized) 31% 73% 225.3 L-tyrosine transporter 73% 708.8
L-valine catabolism Bap2 lo Valine amino-acid permease; Branched-chain amino-acid permease 3 (characterized) 32% 80% 217.2 L-tyrosine transporter 73% 708.8
L-isoleucine catabolism Bap2 lo Leu/Val/Ile amino-acid permease; Branched-chain amino-acid permease 2 (characterized) 31% 76% 216.5 L-tyrosine transporter 73% 708.8
L-tryptophan catabolism TAT lo tryptophan permease (characterized) 31% 79% 213.8 L-tyrosine transporter 73% 708.8
L-leucine catabolism Bap2 lo Leu/Val/Ile amino-acid permease (characterized) 31% 76% 209.1 L-tyrosine transporter 73% 708.8

Sequence Analysis Tools

View AO353_05965 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MADEQLQQGVLKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPSMILGYAIAGFIAF
LIMRQLGEMIVEEPVAGSFSHFAHNYWGSFAGFLSGWNYWVLYVLVGMAELTAVGKYVQF
WWPEVPTWVSAAVFFVLVNLINTMNVKVFGEMEFWFAIIKVVAIIGMIALGCYMLVSGTG
GPQASVSNLWSHGGFFPNGTNGLLMAMAFIMFSFGGLELVGITAAEASEPRKVIPKAINQ
VVYRVLIFYVGALTVLLSLYPWDQLLQTLGASGDAYSGSPFVQIFALIGSNTAAQILNFV
VLTAALSVYNSGVYCNSRMLYGLAEQGDAPKSLMKLNKQGVPLRALGISALITMLCVVVN
YVAPNEALELLFALVVASLMINWAMISLTHLKFRKAMGQRGIVPGFKAFWSPYTNYLCLA
FMAMIIYVMLLIPGVRASVYAIPVWVLILFVFYRIRVARTRALSVA

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory