GapMind for catabolism of small carbon sources

 

Alignments for a candidate for xylF in Pseudomonas fluorescens FW300-N2E3

Align 2-hydroxymuconate-6-semialdehyde hydrolase (EC 3.7.1.9) (characterized)
to candidate AO353_04920 AO353_04920 alpha/beta hydrolase

Query= BRENDA::G3KFX4
         (282 letters)



>FitnessBrowser__pseudo3_N2E3:AO353_04920
          Length = 300

 Score = 60.5 bits (145), Expect = 4e-14
 Identities = 40/113 (35%), Positives = 56/113 (49%), Gaps = 4/113 (3%)

Query: 11  GREILAAGYRTNLHDQGEGFPVLLIHGSGPGVTAWANWRLVMPQLAQNRRVIAPDMLGFG 70
           G+  +  G        G+G P+LLIHG     TA  +W  +   L Q  RVIA DMLGFG
Sbjct: 15  GQSFVFRGQTIRYWVAGQGEPLLLIHGFP---TASWDWHYLWQPLTQRYRVIACDMLGFG 71

Query: 71  YSDRPADGRYHQQRWVEHAIGVLDALGIQQ-ADIVGNSFGGGLALALAIRHPE 122
            S +P D  Y      +    +LD LG++Q   ++ + +G  +A  L  RH E
Sbjct: 72  DSAKPLDHEYCLLEQADLQQALLDYLGVRQPVHLLAHDYGDSVAQELLARHNE 124


Lambda     K      H
   0.323    0.138    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 230
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 282
Length of database: 300
Length adjustment: 26
Effective length of query: 256
Effective length of database: 274
Effective search space:    70144
Effective search space used:    70144
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory