Align 2-hydroxymuconate-6-semialdehyde hydrolase (EC 3.7.1.9) (characterized)
to candidate AO353_04920 AO353_04920 alpha/beta hydrolase
Query= BRENDA::G3KFX4 (282 letters) >FitnessBrowser__pseudo3_N2E3:AO353_04920 Length = 300 Score = 60.5 bits (145), Expect = 4e-14 Identities = 40/113 (35%), Positives = 56/113 (49%), Gaps = 4/113 (3%) Query: 11 GREILAAGYRTNLHDQGEGFPVLLIHGSGPGVTAWANWRLVMPQLAQNRRVIAPDMLGFG 70 G+ + G G+G P+LLIHG TA +W + L Q RVIA DMLGFG Sbjct: 15 GQSFVFRGQTIRYWVAGQGEPLLLIHGFP---TASWDWHYLWQPLTQRYRVIACDMLGFG 71 Query: 71 YSDRPADGRYHQQRWVEHAIGVLDALGIQQ-ADIVGNSFGGGLALALAIRHPE 122 S +P D Y + +LD LG++Q ++ + +G +A L RH E Sbjct: 72 DSAKPLDHEYCLLEQADLQQALLDYLGVRQPVHLLAHDYGDSVAQELLARHNE 124 Lambda K H 0.323 0.138 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 300 Length adjustment: 26 Effective length of query: 256 Effective length of database: 274 Effective search space: 70144 Effective search space used: 70144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory