Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate AO353_06085 AO353_06085 omega amino acid--pyruvate aminotransferase
Query= BRENDA::Q9I6J2 (456 letters) >FitnessBrowser__pseudo3_N2E3:AO353_06085 Length = 449 Score = 274 bits (700), Expect = 5e-78 Identities = 167/454 (36%), Positives = 246/454 (54%), Gaps = 23/454 (5%) Query: 7 NAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVN 66 NA L D H P+T + ++ R+I AEG Y+ D +G K+ D+++GLW Sbjct: 6 NAPVSLASQLKLDAHWMPYTANRNF-QRDPRLIVAAEGSYLIDDKGRKVYDSLSGLWTCG 64 Query: 67 VGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEA 126 G+ R+E+ +A +Q+ L Y+ FQ HP +LA+ I ++ P +NHVFFT SGSE Sbjct: 65 AGHTRKEIQEAVAKQLGTLD-YSPGFQYGHPLSFQLAEKITELTPGNLNHVFFTDSGSEC 123 Query: 127 NDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGM---KALHEQGDFPIPGI 183 DT ++MVR YW KGQ K +IGR GYHG +AG SLGG+ + L Q + + Sbjct: 124 ADTAVKMVRAYWRLKGQSTKTKMIGRARGYHGVNIAGTSLGGVNGNRKLFGQAMMDVDHL 183 Query: 184 VH-IAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPD 242 H + Y G P E G+ AE+L K I N+AA EP+ G+ GV+VPP Sbjct: 184 PHTLLASNAYSRG---MPKEGGIVLAEELLKLIELHDASNIAAVFVEPLAGSAGVLVPPQ 240 Query: 243 TYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGG 302 Y ++REI +++IL + DEVI GFGRTG FG+ +G PDLM IAK +T+G IPMG Sbjct: 241 GYLKRLREICDQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGA 300 Query: 303 VVVRDEIVEV-LNQGG-----EFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETA 356 V+ EI + +NQ EF HG+TYS HPVA A L + +L++E +++ V AE A Sbjct: 301 VIASSEIYQTFMNQATPEYAVEFPHGYTYSAHPVACAAGLAALDLLQKENLVQSV-AEVA 359 Query: 357 PYLQKRWQELADHPLVGEARGVGMVAALEL-VKNKKTRERFTDKGVGMLCREHCFRNGLI 415 P+ + L V + R G+ A+++ ++ R + G+ + ++ G Sbjct: 360 PHFENALHGLKGSKNVIDIRNYGLAGAIQIAARDGDAIVRPFEAGMAL------WKAGFY 413 Query: 416 MRAVGDTMIISPPLVIDPSQIDELITLARKCLDQ 449 +R GDT+ P P +D L + L++ Sbjct: 414 VRFGGDTLQFGPTFNSKPQDLDRLFDAVGEVLNK 447 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 536 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 449 Length adjustment: 33 Effective length of query: 423 Effective length of database: 416 Effective search space: 175968 Effective search space used: 175968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory